BLASTX nr result
ID: Catharanthus22_contig00029787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00029787 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235793.1| PREDICTED: surfeit locus protein 1-like [Sol... 65 1e-08 ref|XP_006470446.1| PREDICTED: surfeit locus protein 1-like [Cit... 64 2e-08 gb|EMJ10505.1| hypothetical protein PRUPE_ppa007867mg [Prunus pe... 63 4e-08 ref|XP_006341513.1| PREDICTED: surfeit locus protein 1-like [Sol... 62 6e-08 ref|XP_006446373.1| hypothetical protein CICLE_v10015784mg [Citr... 62 6e-08 ref|XP_004299519.1| PREDICTED: surfeit locus protein 1-like [Fra... 62 8e-08 ref|XP_002530789.1| surfeit locus protein, putative [Ricinus com... 61 1e-07 ref|XP_002317864.2| hypothetical protein POPTR_0012s04250g [Popu... 60 3e-07 gb|EMT30225.1| hypothetical protein F775_11611 [Aegilops tauschii] 60 3e-07 ref|XP_006841105.1| hypothetical protein AMTR_s00086p00076960 [A... 59 5e-07 ref|XP_004985316.1| PREDICTED: surfeit locus protein 1-like [Set... 59 5e-07 gb|EOY21379.1| Surfeit locus 1 cytochrome c oxidase biogenesis p... 59 5e-07 ref|NP_566592.1| Surfeit locus 1 cytochrome c oxidase biogenesis... 59 5e-07 tpg|DAA43942.1| TPA: hypothetical protein ZEAMMB73_574420 [Zea m... 59 5e-07 tpg|DAA43941.1| TPA: SURF1 [Zea mays] 59 5e-07 tpg|DAA43940.1| TPA: hypothetical protein ZEAMMB73_574420, parti... 59 5e-07 ref|XP_003558568.1| PREDICTED: surfeit locus protein 1-like [Bra... 59 5e-07 ref|XP_002883096.1| hypothetical protein ARALYDRAFT_479277 [Arab... 59 5e-07 ref|XP_002465690.1| hypothetical protein SORBIDRAFT_01g043830 [S... 59 5e-07 ref|NP_001152069.1| SURF1 [Zea mays] gi|195652321|gb|ACG45628.1|... 59 5e-07 >ref|XP_004235793.1| PREDICTED: surfeit locus protein 1-like [Solanum lycopersicum] Length = 334 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 1/92 (1%) Frame = +2 Query: 86 MATSISRILVRNP-RRGGPSSPAKWXXXXXXXXXXXXXXXXXXXXXXXXXXXENDGRSIW 262 MA SIS+ L RN RR G ++ A E G S W Sbjct: 1 MAASISKTLTRNLLRRSGETTQA------LQLRLSSAVASAPAISVTETQPPEKGGPSKW 54 Query: 263 AKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 +KLLLFIPG I FGLG+WQ++RRQ+KI+MLEY Sbjct: 55 SKLLLFIPGVITFGLGSWQIIRRQDKIEMLEY 86 >ref|XP_006470446.1| PREDICTED: surfeit locus protein 1-like [Citrus sinensis] Length = 350 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+K LLF+PG I+FGLGTWQ+LRRQ+KIKMLEY Sbjct: 68 STWSKWLLFVPGAISFGLGTWQILRRQDKIKMLEY 102 >gb|EMJ10505.1| hypothetical protein PRUPE_ppa007867mg [Prunus persica] Length = 353 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 251 RSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 RS W+K LLF+PG ++FGLGTWQ+ RRQEKIKML+Y Sbjct: 67 RSRWSKWLLFLPGAVSFGLGTWQIFRRQEKIKMLDY 102 >ref|XP_006341513.1| PREDICTED: surfeit locus protein 1-like [Solanum tuberosum] Length = 334 Score = 62.4 bits (150), Expect = 6e-08 Identities = 38/92 (41%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +2 Query: 86 MATSISRILVRNP-RRGGPSSPAKWXXXXXXXXXXXXXXXXXXXXXXXXXXXENDGRSIW 262 MA SIS+ L RN RR G ++ A E G S W Sbjct: 1 MAASISKTLTRNLLRRSGETTQA------LQLRLSSAAASAPAISVTETQPPERGGPSKW 54 Query: 263 AKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 + LLLF+PG I FGLG+WQ++RRQ+KI+MLEY Sbjct: 55 SNLLLFVPGVITFGLGSWQIIRRQDKIEMLEY 86 >ref|XP_006446373.1| hypothetical protein CICLE_v10015784mg [Citrus clementina] gi|557548984|gb|ESR59613.1| hypothetical protein CICLE_v10015784mg [Citrus clementina] Length = 350 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+K LLF+PG I+FGLGTWQ+ RRQ+KIKMLEY Sbjct: 68 STWSKWLLFLPGAISFGLGTWQIFRRQDKIKMLEY 102 >ref|XP_004299519.1| PREDICTED: surfeit locus protein 1-like [Fragaria vesca subsp. vesca] Length = 351 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 251 RSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 RS W+K LLF+PG I FGLGTWQ++RRQ+KI+MLEY Sbjct: 67 RSRWSKWLLFLPGAITFGLGTWQIVRRQDKIQMLEY 102 >ref|XP_002530789.1| surfeit locus protein, putative [Ricinus communis] gi|223529644|gb|EEF31590.1| surfeit locus protein, putative [Ricinus communis] Length = 347 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 239 ENDGRSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 E + S W+K LLF+PG I FGLGTWQ+ RRQEKIKML+Y Sbjct: 63 EKERISKWSKWLLFLPGTITFGLGTWQIFRRQEKIKMLDY 102 >ref|XP_002317864.2| hypothetical protein POPTR_0012s04250g [Populus trichocarpa] gi|550326363|gb|EEE96084.2| hypothetical protein POPTR_0012s04250g [Populus trichocarpa] Length = 344 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 239 ENDGRSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 E + S +K LLF+PG I FGLGTWQVLRRQ+KIKMLEY Sbjct: 56 EKESGSRLSKWLLFLPGAITFGLGTWQVLRRQDKIKMLEY 95 >gb|EMT30225.1| hypothetical protein F775_11611 [Aegilops tauschii] Length = 358 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 260 WAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 WAKL LF PG I FGLGTWQ+ RRQEK++MLEY Sbjct: 54 WAKLFLFAPGAITFGLGTWQLFRRQEKVEMLEY 86 >ref|XP_006841105.1| hypothetical protein AMTR_s00086p00076960 [Amborella trichopoda] gi|548842999|gb|ERN02780.1| hypothetical protein AMTR_s00086p00076960 [Amborella trichopoda] Length = 343 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 251 RSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 R W+ L LF+PG I FGLGTWQ+ RRQEKI+MLEY Sbjct: 53 RKRWSSLFLFLPGAITFGLGTWQLFRRQEKIEMLEY 88 >ref|XP_004985316.1| PREDICTED: surfeit locus protein 1-like [Setaria italica] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 59 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 93 >gb|EOY21379.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein isoform 1 [Theobroma cacao] gi|508774124|gb|EOY21380.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein isoform 1 [Theobroma cacao] gi|508774125|gb|EOY21381.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein isoform 1 [Theobroma cacao] gi|508774127|gb|EOY21383.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein isoform 1 [Theobroma cacao] Length = 337 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W++ LF+PG I FGLGTWQ+ RRQ+KIKMLEY Sbjct: 54 STWSRWFLFLPGAITFGLGTWQIFRRQDKIKMLEY 88 >ref|NP_566592.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein [Arabidopsis thaliana] gi|75203836|sp|Q9SE51.1|SURF1_ARATH RecName: Full=Surfeit locus protein 1; Short=Surfeit 1; AltName: Full=Cytochrome c oxidase assembly protein SURF1; AltName: Full=Protein EMBRYO DEFECTIVE 3121; AltName: Full=Surfeit locus 1 cytochrome c oxidase biogenesis protein gi|6630873|gb|AAF19609.1|AF182953_1 Surfeit 1 [Arabidopsis thaliana] gi|89000977|gb|ABD59078.1| At3g17910 [Arabidopsis thaliana] gi|332642502|gb|AEE76023.1| Surfeit locus 1 cytochrome c oxidase biogenesis protein [Arabidopsis thaliana] Length = 354 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 239 ENDGRSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 EN S W++LLLF+PG I FGLG+WQ++RR+EK K LEY Sbjct: 66 ENKRGSKWSQLLLFLPGAITFGLGSWQIVRREEKFKTLEY 105 >tpg|DAA43942.1| TPA: hypothetical protein ZEAMMB73_574420 [Zea mays] Length = 173 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 60 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 94 >tpg|DAA43941.1| TPA: SURF1 [Zea mays] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 60 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 94 >tpg|DAA43940.1| TPA: hypothetical protein ZEAMMB73_574420, partial [Zea mays] Length = 245 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 136 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 170 >ref|XP_003558568.1| PREDICTED: surfeit locus protein 1-like [Brachypodium distachyon] Length = 338 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 49 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 83 >ref|XP_002883096.1| hypothetical protein ARALYDRAFT_479277 [Arabidopsis lyrata subsp. lyrata] gi|297328936|gb|EFH59355.1| hypothetical protein ARALYDRAFT_479277 [Arabidopsis lyrata subsp. lyrata] Length = 354 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 239 ENDGRSIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 EN S W++LLLF+PG I FGLG+WQ++RR+EK K LEY Sbjct: 66 ENKRGSKWSQLLLFLPGAITFGLGSWQIVRREEKFKTLEY 105 >ref|XP_002465690.1| hypothetical protein SORBIDRAFT_01g043830 [Sorghum bicolor] gi|241919544|gb|EER92688.1| hypothetical protein SORBIDRAFT_01g043830 [Sorghum bicolor] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 58 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 92 >ref|NP_001152069.1| SURF1 [Zea mays] gi|195652321|gb|ACG45628.1| SURF1 [Zea mays] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 254 SIWAKLLLFIPGGIAFGLGTWQVLRRQEKIKMLEY 358 S W+KL LF PG I FGLGTWQ+ RRQEKI+ML+Y Sbjct: 60 SAWSKLFLFAPGAITFGLGTWQLFRRQEKIEMLDY 94