BLASTX nr result
ID: Catharanthus22_contig00029740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00029740 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527588.1| hypothetical protein RCOM_1568080 [Ricinus c... 60 4e-07 ref|XP_006826164.1| hypothetical protein AMTR_s05090p00005430, p... 58 2e-06 emb|CAN74973.1| hypothetical protein VITISV_001042 [Vitis vinifera] 57 2e-06 gb|ABQ59165.1| putative gag protein [(Populus tomentosa x P. bol... 57 3e-06 >ref|XP_002527588.1| hypothetical protein RCOM_1568080 [Ricinus communis] gi|223533034|gb|EEF34796.1| hypothetical protein RCOM_1568080 [Ricinus communis] Length = 136 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/74 (37%), Positives = 41/74 (55%) Frame = +2 Query: 11 LKLPLLCGTLGPYDYEAWKQKVESLFYSYGVREEEKFQLVLKSLSYEVNVWWDCKCENRR 190 +K+P G P Y W++KVE +F + EE+K +L S VWWD C+ RR Sbjct: 18 MKIPSFQGRNDPDVYLEWERKVELIFECHNYSEEKKVKLAAVEFSDYAIVWWDQFCKERR 77 Query: 191 RMGAQPIKTWSLMK 232 R G +P+++W MK Sbjct: 78 RYGERPVESWIEMK 91 >ref|XP_006826164.1| hypothetical protein AMTR_s05090p00005430, partial [Amborella trichopoda] gi|548830328|gb|ERM93401.1| hypothetical protein AMTR_s05090p00005430, partial [Amborella trichopoda] Length = 235 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/74 (35%), Positives = 40/74 (54%) Frame = +2 Query: 11 LKLPLLCGTLGPYDYEAWKQKVESLFYSYGVREEEKFQLVLKSLSYEVNVWWDCKCENRR 190 +++P G P Y W++K+E +F + + +K +L + VWWD C NRR Sbjct: 107 MRIPAFQGKSDPEAYLEWEKKMELVFDCHNYSDMKKVKLAAIEFTDYAIVWWDQLCTNRR 166 Query: 191 RMGAQPIKTWSLMK 232 R G +PI+TW MK Sbjct: 167 RSGDRPIETWEAMK 180 >emb|CAN74973.1| hypothetical protein VITISV_001042 [Vitis vinifera] Length = 1281 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/74 (37%), Positives = 41/74 (55%) Frame = +2 Query: 11 LKLPLLCGTLGPYDYEAWKQKVESLFYSYGVREEEKFQLVLKSLSYEVNVWWDCKCENRR 190 +K+PL G P Y W++KVE +F + EE+ +LV+ + +WWD NRR Sbjct: 113 MKIPLFQGKNDPKVYLEWEKKVEFIFECHNYSEEKNVKLVVIEFTDYAIIWWDQLVMNRR 172 Query: 191 RMGAQPIKTWSLMK 232 R +PI+TW MK Sbjct: 173 RNYERPIETWEEMK 186 >gb|ABQ59165.1| putative gag protein [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 180 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 11 LKLPLLCGTLGPYDYEAWKQKVESLFYSYGVREEEKFQLVLKSLSYEVNVWWDCKCENRR 190 LK+P G P Y W++KV+ +F + E++K +LV+ + +WWD +RR Sbjct: 10 LKIPTFQGKNDPEAYLEWEKKVDWIFDCHSYSEQKKVKLVIIEFTEYALIWWDQIVISRR 69 Query: 191 RMGAQPIKTWSLMK 232 R G +P++TW MK Sbjct: 70 RNGERPVQTWGEMK 83