BLASTX nr result
ID: Catharanthus22_contig00029709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00029709 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231452.1| PREDICTED: protein MCM10 homolog [Solanum ly... 60 2e-07 ref|XP_006359695.1| PREDICTED: protein MCM10 homolog [Solanum tu... 59 7e-07 >ref|XP_004231452.1| PREDICTED: protein MCM10 homolog [Solanum lycopersicum] Length = 415 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 297 PKRRGQADMSVFRDAVQDCLDYDHETAKKALKAK 398 PKR G+ADMSVFRDAVQDCLDYD E AKKA K+K Sbjct: 42 PKRMGEADMSVFRDAVQDCLDYDTEIAKKAAKSK 75 >ref|XP_006359695.1| PREDICTED: protein MCM10 homolog [Solanum tuberosum] Length = 415 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 297 PKRRGQADMSVFRDAVQDCLDYDHETAKKALKAK 398 PKR G ADMSVFRDAVQDCLDYD E AKKA K+K Sbjct: 42 PKRMGVADMSVFRDAVQDCLDYDTEIAKKAAKSK 75