BLASTX nr result
ID: Catharanthus22_contig00028928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028928 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006586558.1| PREDICTED: uncharacterized protein LOC102661... 65 1e-08 emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] 60 4e-07 ref|XP_004234727.1| PREDICTED: uncharacterized protein LOC101248... 57 3e-06 >ref|XP_006586558.1| PREDICTED: uncharacterized protein LOC102661920 [Glycine max] Length = 516 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = -3 Query: 218 NLWIVDYGASTHMNCHNR-MTDITPIVPCFIHMLNGSSTVAKFEGSVVLSPSLVLTHVLY 42 N WI+D GAS HM M D+ I PC I M NG+ T A EG V + L+L HVL+ Sbjct: 386 NSWIIDTGASHHMTSTLACMNDVRDIEPCPIGMPNGTRTYATKEGMVTVGDKLMLKHVLF 445 Query: 41 VPNLTYDLLYISQ 3 VPNL +L+ ISQ Sbjct: 446 VPNLNCNLISISQ 458 >emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] Length = 1109 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = -3 Query: 248 NGNFANKDNMNLWIVDYGASTHMN-CHNRMTDITPIVPCFIHMLNGSSTVAKFEGSVVLS 72 N K N+ WI+D GA HM + + D+ I+PC + + NG+ T A E +V L Sbjct: 183 NZMLTGKQNILPWIIDTGAXHHMTGTYECLNDLRDIMPCLVGLPNGAETKALKERTVTLG 242 Query: 71 PSLVLTHVLYVPNLTYDLLYISQ 3 L L HVL+VP L +L+++ Q Sbjct: 243 EKLKLRHVLFVPKLKCNLIFVLQ 265 >ref|XP_004234727.1| PREDICTED: uncharacterized protein LOC101248080 [Solanum lycopersicum] Length = 422 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = -3 Query: 212 WIVDYGASTHMNCH-NRMTDITPIVPCFIHMLNGSSTVAKFEGSVVLSPSLVLTHVLYVP 36 W++D GAS HM + + + DI PI C I + +G+ VA + GSV +S +L+L +VL+VP Sbjct: 313 WLIDSGASHHMTGNFSSLYDIMPIPECSIGLPDGTRVVANYCGSVQISVNLILNNVLFVP 372 Query: 35 NLTYDLLYI 9 NL +L+ + Sbjct: 373 NLKCNLISV 381