BLASTX nr result
ID: Catharanthus22_contig00028821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028821 (643 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002466537.1| hypothetical protein SORBIDRAFT_01g009615 [S... 57 4e-06 >ref|XP_002466537.1| hypothetical protein SORBIDRAFT_01g009615 [Sorghum bicolor] gi|241920391|gb|EER93535.1| hypothetical protein SORBIDRAFT_01g009615 [Sorghum bicolor] Length = 229 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = -2 Query: 525 KFLRHKYFRNTPIHIL--KAGASHIWRSLIQGWKLCKYGIAWNIGDGSQINFWFGTWM 358 K L+ KYF +T + + KAG S+ WRS+++G K+ K G+ W +GDG +N W W+ Sbjct: 114 KVLKAKYFPDTSVLLAQPKAGMSYSWRSILEGLKIVKEGLIWRVGDGVGLNIWANPWI 171