BLASTX nr result
ID: Catharanthus22_contig00028764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028764 (510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66637.1| hypothetical protein VITISV_011340 [Vitis vinifera] 42 6e-06 emb|CAN73567.1| hypothetical protein VITISV_003451 [Vitis vinifera] 42 6e-06 >emb|CAN66637.1| hypothetical protein VITISV_011340 [Vitis vinifera] Length = 1316 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 6/51 (11%) Frame = +3 Query: 372 KYCSIYFVYLLKVKMR------LAIFEVENQLRKEIKRLGSNKNGEHEAPF 506 KYC +VYLLK K L EVENQL K+IK L S++ GE+E+PF Sbjct: 559 KYC---YVYLLKSKDEAIEKFVLYKTEVENQLNKKIKVLRSDRGGEYESPF 606 Score = 33.9 bits (76), Expect(2) = 6e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 254 QKSFSTASGVCDVVTGCYSDVCDLKFVQTQEGNK 355 + SF + + + +SD+CDLKFVQT+ GNK Sbjct: 515 RSSFQSVERNTEPLDLIHSDICDLKFVQTRGGNK 548 >emb|CAN73567.1| hypothetical protein VITISV_003451 [Vitis vinifera] Length = 1277 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 6/51 (11%) Frame = +3 Query: 372 KYCSIYFVYLLKVKMR------LAIFEVENQLRKEIKRLGSNKNGEHEAPF 506 KYC +VYLLK K L EVENQL K+IK L S++ GE+E+PF Sbjct: 559 KYC---YVYLLKSKDEAIEKFVLYKTEVENQLNKKIKVLRSDRGGEYESPF 606 Score = 33.9 bits (76), Expect(2) = 6e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 254 QKSFSTASGVCDVVTGCYSDVCDLKFVQTQEGNK 355 + SF + + + +SD+CDLKFVQT+ GNK Sbjct: 515 RSSFQSVERNTEPLDLIHSDICDLKFVQTRGGNK 548