BLASTX nr result
ID: Catharanthus22_contig00028706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028706 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 97 3e-18 gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 85 5e-15 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 6e-10 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +3 Query: 3 PPWKEPLPSCLIREASIHQRRLKVLSEPCWIVTHHTALKPNLWWIQGDKV 152 PPW+EPL SCLI ASIHQRRLKVLSEPCWIVTHHTALKPNLWWI D + Sbjct: 4 PPWEEPLLSCLIVGASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 85.1 bits (209), Expect(2) = 5e-15 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -2 Query: 176 MGQRIKRFDFVSLDPPQVGFESRVMGDYPARFGEHF*SALVNGS 45 MGQRIKRFDFVS D PQVGFESRVMGDYPARFGEHF SALVNGS Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGS 44 Score = 21.2 bits (43), Expect(2) = 5e-15 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 37 IKQEGSGSFHGG 2 IKQE SG HGG Sbjct: 47 IKQERSGYSHGG 58 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 176 MGQRIKRFDFVSLDPPQVGFESRVMGDYPARFGE 75 MGQRIKRFDFVS D PQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 63.2 bits (152), Expect = 4e-08 Identities = 37/67 (55%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +3 Query: 9 WKEPLPSCLIREASIHQRRLKVLSEPCWIVTHHTALKPNLW-WIQGDKVKALDPLPHTWR 185 +K L S L R SI Q RLKVL EPC I+T++T QGD VKALDPLPHT + Sbjct: 6 YKNSLLSYLTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLK 65 Query: 186 CSSPPIK 206 SS PIK Sbjct: 66 GSSTPIK 72