BLASTX nr result
ID: Catharanthus22_contig00028678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028678 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 49 1e-05 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 48.9 bits (115), Expect(2) = 1e-05 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 158 ERLDHAFYNSKWFQLFPKLQVNHLIIIFSDHCPLFI 265 ERLD A NS+W LFP +V HL FSDHCPL I Sbjct: 196 ERLDRALVNSEWLDLFPDTKVIHLPRTFSDHCPLLI 231 Score = 25.8 bits (55), Expect(2) = 1e-05 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 103 FSGPKFT*LNKRSGGRL 153 F GPKFT N R+GG L Sbjct: 177 FQGPKFTWTNGRTGGSL 193