BLASTX nr result
ID: Catharanthus22_contig00028644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028644 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359527.1| PREDICTED: uncharacterized protein LOC102589... 66 6e-09 gb|EOY31304.1| Uveal autoantigen with coiled-coil domains and an... 66 6e-09 gb|EOY31303.1| Uveal autoantigen with coiled-coil domains and an... 66 6e-09 ref|XP_004242709.1| PREDICTED: uncharacterized protein LOC101251... 66 6e-09 emb|CBI25595.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002265610.1| PREDICTED: uncharacterized protein LOC100263... 66 6e-09 gb|EXB87681.1| hypothetical protein L484_006425 [Morus notabilis] 65 1e-08 ref|XP_002532497.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_004146705.1| PREDICTED: uncharacterized protein LOC101215... 63 4e-08 gb|ESW27106.1| hypothetical protein PHAVU_003G174400g [Phaseolus... 62 6e-08 ref|XP_002309313.2| hypothetical protein POPTR_0006s20480g [Popu... 62 6e-08 gb|EMJ04827.1| hypothetical protein PRUPE_ppa003939mg [Prunus pe... 62 6e-08 ref|XP_003550799.1| PREDICTED: uncharacterized protein LOC100819... 62 1e-07 ref|XP_003541495.1| PREDICTED: uncharacterized protein LOC100811... 62 1e-07 ref|XP_006473941.1| PREDICTED: uncharacterized protein LOC102616... 60 2e-07 ref|XP_006453714.1| hypothetical protein CICLE_v10007895mg [Citr... 60 2e-07 ref|XP_004508401.1| PREDICTED: uncharacterized protein LOC101506... 60 3e-07 ref|XP_004288756.1| PREDICTED: uncharacterized protein LOC101306... 59 7e-07 ref|XP_002324573.1| hypothetical protein POPTR_0018s12250g [Popu... 59 7e-07 ref|XP_003609510.1| hypothetical protein MTR_4g116470 [Medicago ... 59 7e-07 >ref|XP_006359527.1| PREDICTED: uncharacterized protein LOC102589711 [Solanum tuberosum] Length = 522 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYSSLHDSITSLCK +LPF FKK+RIPA Sbjct: 4 SYTPTYYSSLHDSITSLCKTILPFPFKKRRIPA 36 >gb|EOY31304.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 2 [Theobroma cacao] Length = 406 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK +LPFSFKK+R+PA Sbjct: 4 SYTPTYYSTLHDSITSLCKTILPFSFKKRRLPA 36 >gb|EOY31303.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 1 [Theobroma cacao] Length = 538 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK +LPFSFKK+R+PA Sbjct: 4 SYTPTYYSTLHDSITSLCKTILPFSFKKRRLPA 36 >ref|XP_004242709.1| PREDICTED: uncharacterized protein LOC101251596 [Solanum lycopersicum] Length = 517 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYSSLHDSITSLCK +LPF FKK+RIPA Sbjct: 4 SYTPTYYSSLHDSITSLCKTILPFPFKKRRIPA 36 >emb|CBI25595.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK +LPFSFKK+R+PA Sbjct: 3 SYTPTYYSTLHDSITSLCKTILPFSFKKRRLPA 35 >ref|XP_002265610.1| PREDICTED: uncharacterized protein LOC100263642 [Vitis vinifera] Length = 554 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK +LPFSFKK+R+PA Sbjct: 3 SYTPTYYSTLHDSITSLCKTILPFSFKKRRLPA 35 >gb|EXB87681.1| hypothetical protein L484_006425 [Morus notabilis] Length = 538 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK +LPF+FKK+R+PA Sbjct: 4 SYTPTYYSTLHDSITSLCKTILPFNFKKRRLPA 36 >ref|XP_002532497.1| conserved hypothetical protein [Ricinus communis] gi|223527772|gb|EEF29873.1| conserved hypothetical protein [Ricinus communis] Length = 552 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 +YTPTYYS+LHDSITSLCK +LPFSFKK+R+PA Sbjct: 4 TYTPTYYSTLHDSITSLCKTILPFSFKKRRLPA 36 >ref|XP_004146705.1| PREDICTED: uncharacterized protein LOC101215616 [Cucumis sativus] gi|449505393|ref|XP_004162455.1| PREDICTED: uncharacterized protein LOC101226755 [Cucumis sativus] Length = 359 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SYTPTYYS+LHDSITSLCK++LPFSFKK+ +PA Sbjct: 4 SYTPTYYSTLHDSITSLCKSILPFSFKKRCLPA 36 >gb|ESW27106.1| hypothetical protein PHAVU_003G174400g [Phaseolus vulgaris] Length = 494 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 102 SSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 S YTPTYYS+LHDSITSLCK +LPFSFKK+ +PA Sbjct: 4 SYYTPTYYSTLHDSITSLCKTILPFSFKKRPLPA 37 >ref|XP_002309313.2| hypothetical protein POPTR_0006s20480g [Populus trichocarpa] gi|550336723|gb|EEE92836.2| hypothetical protein POPTR_0006s20480g [Populus trichocarpa] Length = 588 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 123 KKFLNMGSSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 K+ M +YTP YYS+LHDSITSLCK +LPFSFKKKR+ A Sbjct: 46 KRSSKMVHTYTPAYYSTLHDSITSLCKTILPFSFKKKRLTA 86 >gb|EMJ04827.1| hypothetical protein PRUPE_ppa003939mg [Prunus persica] Length = 539 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 SY PTYYS+LHDS+T+LCK +LPFSFKK+R+PA Sbjct: 4 SYAPTYYSTLHDSVTNLCKTILPFSFKKRRLPA 36 >ref|XP_003550799.1| PREDICTED: uncharacterized protein LOC100819771 [Glycine max] Length = 490 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 102 SSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 S YTPTYYS+LHDS+TSLCK +LPFSFKK+ +PA Sbjct: 4 SYYTPTYYSTLHDSLTSLCKTILPFSFKKRPLPA 37 >ref|XP_003541495.1| PREDICTED: uncharacterized protein LOC100811675 [Glycine max] Length = 493 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 102 SSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 S YTPTYYS+LHDS+TSLCK +LPFSFKK+ +PA Sbjct: 4 SYYTPTYYSTLHDSLTSLCKTILPFSFKKRPLPA 37 >ref|XP_006473941.1| PREDICTED: uncharacterized protein LOC102616671 [Citrus sinensis] Length = 558 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 +YTPTYY+SLHDSITSLCK +LPFS KKKR+ A Sbjct: 4 TYTPTYYTSLHDSITSLCKTILPFSLKKKRLAA 36 >ref|XP_006453714.1| hypothetical protein CICLE_v10007895mg [Citrus clementina] gi|557556940|gb|ESR66954.1| hypothetical protein CICLE_v10007895mg [Citrus clementina] Length = 558 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 +YTPTYY+SLHDSITSLCK +LPFS KKKR+ A Sbjct: 4 TYTPTYYTSLHDSITSLCKTILPFSLKKKRLAA 36 >ref|XP_004508401.1| PREDICTED: uncharacterized protein LOC101506790 [Cicer arietinum] Length = 484 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 102 SSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 S+YTPTYYS+LHDSITS CK +LPF+FKK+ +P+ Sbjct: 4 SNYTPTYYSTLHDSITSFCKTILPFNFKKRSLPS 37 >ref|XP_004288756.1| PREDICTED: uncharacterized protein LOC101306087 [Fragaria vesca subsp. vesca] Length = 518 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRI 7 SY PTYYSSLH+S+TSLCK +LPFSFKK+R+ Sbjct: 4 SYAPTYYSSLHESVTSLCKTILPFSFKKRRL 34 >ref|XP_002324573.1| hypothetical protein POPTR_0018s12250g [Populus trichocarpa] gi|222866007|gb|EEF03138.1| hypothetical protein POPTR_0018s12250g [Populus trichocarpa] Length = 547 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 99 SYTPTYYSSLHDSITSLCKNLLPFSFKKKRI 7 +YTP YYS+LHDSITS+CK +LPFSFKKKR+ Sbjct: 4 TYTPAYYSTLHDSITSICKTILPFSFKKKRL 34 >ref|XP_003609510.1| hypothetical protein MTR_4g116470 [Medicago truncatula] gi|355510565|gb|AES91707.1| hypothetical protein MTR_4g116470 [Medicago truncatula] Length = 485 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 102 SSYTPTYYSSLHDSITSLCKNLLPFSFKKKRIPA 1 ++YTPTYYS+LHDSITS CK +LPF+FKK+ +P+ Sbjct: 4 TNYTPTYYSTLHDSITSFCKTILPFNFKKRSLPS 37