BLASTX nr result
ID: Catharanthus22_contig00028571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028571 (204 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247677.1| PREDICTED: uncharacterized protein LOC101254... 56 4e-06 >ref|XP_004247677.1| PREDICTED: uncharacterized protein LOC101254942 [Solanum lycopersicum] Length = 1118 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 5 LRFLVALYRWCTEKNPADRPTARKLYELLEKASTCTDSTNVEQ 133 LRFLV++YRWCTEK+P DRPTA LY LL +C DS + +Q Sbjct: 1074 LRFLVSIYRWCTEKDPNDRPTAENLYNLL---LSCADSLSSQQ 1113