BLASTX nr result
ID: Catharanthus22_contig00028429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00028429 (839 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314941.1| ubiquitin-conjugating enzyme family protein ... 70 9e-10 gb|EXB71070.1| Ubiquitin-conjugating enzyme E2 32 [Morus notabilis] 69 2e-09 ref|XP_006488848.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 ref|XP_006349836.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 gb|ESW19352.1| hypothetical protein PHAVU_006G117400g [Phaseolus... 69 2e-09 ref|XP_006419397.1| hypothetical protein CICLE_v10005518mg [Citr... 69 2e-09 gb|AGZ15409.1| ubiquitin-conjugating enzyme E2 32 [Phaseolus vul... 69 2e-09 ref|XP_006840438.1| hypothetical protein AMTR_s00045p00166680 [A... 69 2e-09 gb|EOY06705.1| Ubiquitin-conjugating enzyme 32 [Theobroma cacao] 69 2e-09 ref|XP_004295089.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 gb|EMJ26953.1| hypothetical protein PRUPE_ppa009066mg [Prunus pe... 69 2e-09 ref|XP_004252922.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 ref|XP_004134243.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 gb|AFK49554.1| unknown [Medicago truncatula] 69 2e-09 gb|AFK49409.1| unknown [Lotus japonicus] 69 2e-09 ref|XP_003546320.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 ref|XP_003533168.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-09 ref|XP_003609764.1| Ubiquitin carrier protein E2 [Medicago trunc... 69 2e-09 ref|XP_002519212.1| non-canonical ubiquitin conjugating enzyme, ... 69 2e-09 ref|XP_002312335.1| ubiquitin-conjugating enzyme family protein ... 69 2e-09 >ref|XP_002314941.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] gi|222863981|gb|EEF01112.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] Length = 308 Score = 70.1 bits (170), Expect = 9e-10 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWSGNLLFLLL 108 PNGRFETQTKICLSISNHHPEHWQPSWS L L Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWSVRTALLAL 117 >gb|EXB71070.1| Ubiquitin-conjugating enzyme E2 32 [Morus notabilis] Length = 302 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_006488848.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Citrus sinensis] Length = 301 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_006349836.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Solanum tuberosum] Length = 301 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >gb|ESW19352.1| hypothetical protein PHAVU_006G117400g [Phaseolus vulgaris] Length = 309 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_006419397.1| hypothetical protein CICLE_v10005518mg [Citrus clementina] gi|557521270|gb|ESR32637.1| hypothetical protein CICLE_v10005518mg [Citrus clementina] Length = 301 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >gb|AGZ15409.1| ubiquitin-conjugating enzyme E2 32 [Phaseolus vulgaris] Length = 309 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_006840438.1| hypothetical protein AMTR_s00045p00166680 [Amborella trichopoda] gi|548842156|gb|ERN02113.1| hypothetical protein AMTR_s00045p00166680 [Amborella trichopoda] Length = 319 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >gb|EOY06705.1| Ubiquitin-conjugating enzyme 32 [Theobroma cacao] Length = 304 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_004295089.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Fragaria vesca subsp. vesca] Length = 303 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >gb|EMJ26953.1| hypothetical protein PRUPE_ppa009066mg [Prunus persica] Length = 307 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_004252922.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Solanum lycopersicum] Length = 301 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_004134243.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Cucumis sativus] gi|449503860|ref|XP_004162210.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Cucumis sativus] Length = 297 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >gb|AFK49554.1| unknown [Medicago truncatula] Length = 307 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >gb|AFK49409.1| unknown [Lotus japonicus] Length = 311 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_003546320.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Glycine max] Length = 306 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_003533168.1| PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Glycine max] Length = 308 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_003609764.1| Ubiquitin carrier protein E2 [Medicago truncatula] gi|355510819|gb|AES91961.1| Ubiquitin carrier protein E2 [Medicago truncatula] Length = 326 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 81 PNGRFETQTKICLSISNHHPEHWQPSWS 108 >ref|XP_002519212.1| non-canonical ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223541527|gb|EEF43076.1| non-canonical ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 309 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109 >ref|XP_002312335.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] gi|222852155|gb|EEE89702.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] Length = 310 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 PNGRFETQTKICLSISNHHPEHWQPSWS 84 PNGRFETQTKICLSISNHHPEHWQPSWS Sbjct: 82 PNGRFETQTKICLSISNHHPEHWQPSWS 109