BLASTX nr result
ID: Catharanthus22_contig00027968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00027968 (1006 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307965.2| hypothetical protein POPTR_0006s03510g [Popu... 60 1e-06 >ref|XP_002307965.2| hypothetical protein POPTR_0006s03510g [Populus trichocarpa] gi|550335376|gb|EEE91488.2| hypothetical protein POPTR_0006s03510g [Populus trichocarpa] Length = 99 Score = 60.5 bits (145), Expect = 1e-06 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 752 CYAAEKAKISSFKLDAXXXXXXXXTVMNGHKGFKGNA--DSEEIFGADKRKVYTGPNPLH 925 CYA K SS K + + N G K NA D EIFGADKRKVYTGPNPLH Sbjct: 38 CYAVGYGKFSSVKGGSSSELRNNPAMSNSVGGLKRNANKDGNEIFGADKRKVYTGPNPLH 97 Query: 926 NR 931 NR Sbjct: 98 NR 99