BLASTX nr result
ID: Catharanthus22_contig00027966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00027966 (422 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340556.1| PREDICTED: ecotropic viral integration site ... 57 2e-06 >ref|XP_006340556.1| PREDICTED: ecotropic viral integration site 5 protein homolog [Solanum tuberosum] Length = 827 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +2 Query: 47 DMPTRKPGLLS--FGLGWRDKNKGKAGNFVTNADSKPGNEGSEKSSAQNQLNGHQ 205 ++P RK LLS FGLGWRDKNKGK V DSKP NE + ++ Q ++NGHQ Sbjct: 767 EIPARKISLLSRPFGLGWRDKNKGKPAEEVN--DSKPVNEETSPNTQQKEMNGHQ 819