BLASTX nr result
ID: Catharanthus22_contig00027938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00027938 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 111 9e-23 gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protei... 110 3e-22 emb|CBI18929.3| unnamed protein product [Vitis vinifera] 110 3e-22 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutr... 108 1e-21 gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] 106 3e-21 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 106 3e-21 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 106 3e-21 ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Caps... 105 5e-21 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 104 1e-20 ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-20 ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 101 9e-20 ref|XP_006655248.1| PREDICTED: pentatricopeptide repeat-containi... 101 1e-19 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 100 2e-19 ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004515286.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|ESW24601.1| hypothetical protein PHAVU_004G144300g [Phaseolus... 99 5e-19 gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus pe... 99 6e-19 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 111 bits (278), Expect = 9e-23 Identities = 51/60 (85%), Positives = 53/60 (88%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNTKPG PL V+KNLRIC DCHAVIKFIS FE+REIFVRDT RFHQFK GVCSCGD W Sbjct: 665 GLLNTKPGFPLQVIKNLRICRDCHAVIKFISDFEKREIFVRDTNRFHQFKGGVCSCGDYW 724 >gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 758 Score = 110 bits (274), Expect = 3e-22 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG+PL ++KNLRICGDCHAVIKFISGFE REI+VRDT RFH FK+GVCSC D W Sbjct: 699 GLLNTPPGSPLQIIKNLRICGDCHAVIKFISGFEGREIYVRDTNRFHHFKDGVCSCRDYW 758 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 110 bits (274), Expect = 3e-22 Identities = 49/60 (81%), Positives = 50/60 (83%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRICGDCH VIKFIS FE REIFVRDT RFH FKEG CSCGD W Sbjct: 328 GLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKEGACSCGDYW 387 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 110 bits (274), Expect = 3e-22 Identities = 49/60 (81%), Positives = 50/60 (83%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRICGDCH VIKFIS FE REIFVRDT RFH FKEG CSCGD W Sbjct: 699 GLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKEGACSCGDYW 758 >ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] gi|557094189|gb|ESQ34771.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] Length = 760 Score = 108 bits (269), Expect = 1e-21 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT GTPL V+KNLRICGDCH+VIKFISG+ REIFVRDT RFH FK+G+CSCGD W Sbjct: 701 GLLNTPDGTPLQVIKNLRICGDCHSVIKFISGYAGREIFVRDTNRFHHFKDGICSCGDFW 760 >gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] Length = 728 Score = 106 bits (265), Expect = 3e-21 Identities = 47/60 (78%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG+ L V+KNLRICGDCH VIKFIS FE+REIFVRDT RFH FK+G CSCGD W Sbjct: 669 GLLNTPPGSSLRVIKNLRICGDCHVVIKFISSFEQREIFVRDTNRFHHFKDGHCSCGDYW 728 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 106 bits (265), Expect = 3e-21 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT GTPL V+KNLRICGDCHAVIKFIS + REIF+RDT RFH FK+G+CSCGD W Sbjct: 701 GLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGICSCGDFW 760 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 106 bits (265), Expect = 3e-21 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT GTPL V+KNLRICGDCHAVIKFIS + REIF+RDT RFH FK+G+CSCGD W Sbjct: 701 GLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGICSCGDFW 760 >ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] gi|482575552|gb|EOA39739.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] Length = 760 Score = 105 bits (263), Expect = 5e-21 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT GTPL V+KNLRICGDCH+VIKFIS + REIFVRDT RFH FK+G+CSCGD W Sbjct: 701 GLLNTPDGTPLQVIKNLRICGDCHSVIKFISSYAGREIFVRDTNRFHHFKDGICSCGDFW 760 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 104 bits (259), Expect = 1e-20 Identities = 45/60 (75%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 G+LNT G+P+ V KNLRICGDCHAVIKFISGFE REI VRDT R+H FK+G+CSCGD W Sbjct: 1004 GILNTSRGSPIRVTKNLRICGDCHAVIKFISGFEGREISVRDTNRYHHFKDGICSCGDYW 1063 >ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Brachypodium distachyon] Length = 661 Score = 103 bits (258), Expect = 2e-20 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GL++T+PGTPL V+KNLRICGDCH +KFIS FE+REI VRDT RFH FK+G CSCGD W Sbjct: 602 GLISTRPGTPLRVIKNLRICGDCHEAMKFISSFEQREISVRDTNRFHHFKDGKCSCGDYW 661 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 102 bits (255), Expect = 4e-20 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG+ L V+KNLRICGDCH+VIKFIS E REI VRDT RFH FK+GVCSCGD W Sbjct: 696 GLLNTPPGSSLRVIKNLRICGDCHSVIKFISSLEGREISVRDTNRFHHFKDGVCSCGDYW 755 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 102 bits (254), Expect = 5e-20 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRIC DCHAVIK IS E REI+VRDT RFH FK+GVCSCGD W Sbjct: 689 GLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRFHHFKDGVCSCGDFW 748 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 101 bits (252), Expect = 9e-20 Identities = 43/60 (71%), Positives = 48/60 (80%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 G+LNT PGT L V+KNLRICGDCH IKFIS FE REI+VRD R+H F EG+CSCGD W Sbjct: 769 GILNTNPGTSLRVIKNLRICGDCHTFIKFISSFEGREIYVRDANRYHHFNEGICSCGDYW 828 >ref|XP_006655248.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Oryza brachyantha] Length = 584 Score = 101 bits (251), Expect = 1e-19 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GL++T GTP+ V+KNLRICGDCH IKFIS FEEREI+VRDT RFH FK+G CSC D W Sbjct: 525 GLISTSQGTPIRVIKNLRICGDCHEAIKFISSFEEREIYVRDTNRFHHFKDGKCSCADYW 584 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 100 bits (249), Expect = 2e-19 Identities = 44/60 (73%), Positives = 49/60 (81%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GL++T PGTPL V+KNLRICGDCH +KFIS FE REI VRDT RFH FK+G CSCGD W Sbjct: 603 GLISTSPGTPLRVIKNLRICGDCHEAMKFISCFEGREISVRDTNRFHHFKDGKCSCGDYW 662 >ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 601 Score = 100 bits (248), Expect = 3e-19 Identities = 45/60 (75%), Positives = 48/60 (80%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRIC DCHAVIK IS E REI+VRDT R H FK+GVCSCGD W Sbjct: 542 GLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRLHHFKDGVCSCGDFW 601 >ref|XP_004515286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Cicer arietinum] Length = 730 Score = 99.8 bits (247), Expect = 3e-19 Identities = 45/60 (75%), Positives = 48/60 (80%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRIC DCHAVIK IS E REI+VRDT RFH FK+GVCSC D W Sbjct: 671 GLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEAREIYVRDTNRFHHFKDGVCSCEDFW 730 >gb|ESW24601.1| hypothetical protein PHAVU_004G144300g [Phaseolus vulgaris] Length = 601 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/60 (73%), Positives = 48/60 (80%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLNT PG PL V+KNLRIC DCHAVIK IS E REI++RDT RFH K+GVCSCGD W Sbjct: 542 GLLNTSPGQPLQVIKNLRICDDCHAVIKAISRLEGREIYIRDTNRFHHIKDGVCSCGDFW 601 >gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica] Length = 654 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/60 (75%), Positives = 49/60 (81%) Frame = +3 Query: 3 GLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKEGVCSCGDVW 182 GLLN+ PG+ L V+KNLRICGDCHAVIKFIS FE REI VRDT FH FK+GVCSC D W Sbjct: 595 GLLNSPPGSSLRVIKNLRICGDCHAVIKFISSFEGREISVRDTNLFHHFKDGVCSCEDYW 654