BLASTX nr result
ID: Catharanthus22_contig00027784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00027784 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476283.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 57 3e-06 >ref|XP_006476283.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Citrus sinensis] Length = 228 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 114 LHYVLKLQRFPGSGRFLMWLAQRTPNSKNYLGLEIRQK 1 L Y+ ++ PGSGRFL+WLA+R P+S NYLGLEIRQK Sbjct: 39 LTYISNFEKPPGSGRFLIWLARRNPDSGNYLGLEIRQK 76