BLASTX nr result
ID: Catharanthus22_contig00027062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00027062 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 79 8e-13 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 74 2e-11 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 4 LSWYGRTAAPREILLYTSSRTRFLNRTSIGERCKHREV 117 LSWYGRTAA REILLYTSSRTRFLNRTSIGERCKHREV Sbjct: 47 LSWYGRTAAQREILLYTSSRTRFLNRTSIGERCKHREV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -2 Query: 142 FRLVRDRFTPHGAYTSRLSKFCSKTSSENLYREGFPAAL 26 FRLVRDRFTP GAYTSRLSKFCSKTS ENLYREGFP L Sbjct: 359 FRLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFPGWL 397