BLASTX nr result
ID: Catharanthus22_contig00026919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00026919 (769 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283261.1| PREDICTED: uncharacterized protein LOC100265... 57 5e-06 >ref|XP_002283261.1| PREDICTED: uncharacterized protein LOC100265682 [Vitis vinifera] Length = 75 Score = 57.4 bits (137), Expect = 5e-06 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = -3 Query: 575 GCSTPKREEYKIPMMSAXXXXXXXXRCDWGGGGMKKETPKNGYFNPPDDLELLFTMPPRR 396 GCSTPKR E +I + K E PKNGYF PPD LE LFTM PRR Sbjct: 17 GCSTPKRRECQIGVADCPPAPKKKPF----SYKKKLEAPKNGYFQPPD-LEFLFTMAPRR 71 Query: 395 QACA 384 QACA Sbjct: 72 QACA 75