BLASTX nr result
ID: Catharanthus22_contig00026911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00026911 (1339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB01353.1| unnamed protein product [Arabidopsis thaliana] 59 4e-06 >dbj|BAB01353.1| unnamed protein product [Arabidopsis thaliana] Length = 307 Score = 59.3 bits (142), Expect = 4e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 1238 SLCLMLLTEATPKAIMRTMGVKGLTLFHLKSHLQ 1339 SLC + L EATPK IMRTMGVKGLTL+HLKSHLQ Sbjct: 74 SLCSVSLLEATPKTIMRTMGVKGLTLYHLKSHLQ 107