BLASTX nr result
ID: Catharanthus22_contig00026688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00026688 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465408.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006427149.1| hypothetical protein CICLE_v10024866mg [Citr... 69 5e-10 ref|XP_002303270.2| pentatricopeptide repeat-containing family p... 67 2e-09 gb|EMJ18480.1| hypothetical protein PRUPE_ppa017680mg [Prunus pe... 66 5e-09 gb|EXB23110.1| hypothetical protein L484_016122 [Morus notabilis] 65 7e-09 ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 gb|EXC45444.1| hypothetical protein L484_000697 [Morus notabilis] 64 2e-08 ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 2e-08 ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|NP_173004.1| pentatricopeptide repeat-containing protein [Ar... 64 2e-08 gb|EOY26599.1| Tetratricopeptide repeat (TPR)-like superfamily p... 63 4e-08 ref|XP_006416898.1| hypothetical protein EUTSA_v10006770mg [Eutr... 63 5e-08 ref|XP_002890108.1| pentatricopeptide repeat-containing protein ... 63 5e-08 ref|XP_006341663.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004305312.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004235725.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006306315.1| hypothetical protein CARUB_v10012185mg [Caps... 60 2e-07 emb|CBI36234.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_006853748.1| hypothetical protein AMTR_s00056p00185560 [A... 59 7e-07 ref|XP_004506883.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_006465408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Citrus sinensis] Length = 879 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SK+VRR+I VRD EHFHHFKDGTCSCGDEGY Sbjct: 837 KFISKIVRRDIFVRDTEHFHHFKDGTCSCGDEGY 870 >ref|XP_006427149.1| hypothetical protein CICLE_v10024866mg [Citrus clementina] gi|557529139|gb|ESR40389.1| hypothetical protein CICLE_v10024866mg [Citrus clementina] Length = 877 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SK+VRR+I VRD EHFHHFKDGTCSCGDEGY Sbjct: 835 KFISKIVRRDIFVRDTEHFHHFKDGTCSCGDEGY 868 >ref|XP_002303270.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550342491|gb|EEE78249.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 786 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SK+VRREISVRD E FHHFKDG CSCGDEGY Sbjct: 752 KFISKIVRREISVRDTEQFHHFKDGLCSCGDEGY 785 >gb|EMJ18480.1| hypothetical protein PRUPE_ppa017680mg [Prunus persica] Length = 790 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SKVVRR+ISVRD E FHHFKDG+C+CGDEGY Sbjct: 751 KFISKVVRRDISVRDTEKFHHFKDGSCTCGDEGY 784 >gb|EXB23110.1| hypothetical protein L484_016122 [Morus notabilis] Length = 880 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S VVRREISVRD E FHHFKDG CSCGDEGY Sbjct: 843 KFISTVVRREISVRDVEEFHHFKDGICSCGDEGY 876 >ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Vitis vinifera] Length = 872 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SKVVRR ISVRD E FHHFKDG CSCGDEGY Sbjct: 835 KFISKVVRRGISVRDTEQFHHFKDGVCSCGDEGY 868 >gb|EXC45444.1| hypothetical protein L484_000697 [Morus notabilis] Length = 880 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S VVRREISVRD E +HHFKDG CSCGDEGY Sbjct: 843 KFISTVVRREISVRDVEEYHHFKDGICSCGDEGY 876 >ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S +VRREISVRD E +HHFKDG CSCGDEGY Sbjct: 838 KFISTIVRREISVRDVEEYHHFKDGVCSCGDEGY 871 >ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S +VRREISVRD E +HHFKDG CSCGDEGY Sbjct: 838 KFISTIVRREISVRDVEEYHHFKDGVCSCGDEGY 871 >ref|NP_173004.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75191104|sp|Q9M9E2.1|PPR45_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g15510, chloroplastic; Flags: Precursor gi|8072389|gb|AAF71977.1|AC013453_2 Hypothetical protein [Arabidopsis thaliana] gi|300825685|gb|ADK35876.1| chloroplast vanilla cream 1 [Arabidopsis thaliana] gi|332191210|gb|AEE29331.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 866 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGD 95 +F SK VRREISVRDAEHFHHFKDG CSCGD Sbjct: 836 KFISKTVRREISVRDAEHFHHFKDGECSCGD 866 >gb|EOY26599.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 873 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEG 101 +F SK+VRREI+VRD E FHHFKDGTCSCGD G Sbjct: 836 KFISKIVRREITVRDTEQFHHFKDGTCSCGDVG 868 >ref|XP_006416898.1| hypothetical protein EUTSA_v10006770mg [Eutrema salsugineum] gi|557094669|gb|ESQ35251.1| hypothetical protein EUTSA_v10006770mg [Eutrema salsugineum] Length = 867 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGD 95 +F SK VRREISVRDAEHFHHF+DG CSCGD Sbjct: 837 KFISKTVRREISVRDAEHFHHFRDGECSCGD 867 >ref|XP_002890108.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335950|gb|EFH66367.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 866 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGD 95 +F SK VRREISVRD+EHFHHFKDG CSCGD Sbjct: 836 KFISKTVRREISVRDSEHFHHFKDGECSCGD 866 >ref|XP_006341663.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Solanum tuberosum] Length = 876 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S+VVRREI+VRD E FHHFKDG C+CGDE Y Sbjct: 839 KFISEVVRREIAVRDTEQFHHFKDGRCTCGDENY 872 >ref|XP_004305312.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 877 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SKVVRREI VRD E FHHFKDG C+C DEGY Sbjct: 838 KFISKVVRREICVRDTEKFHHFKDGFCTCADEGY 871 >ref|XP_004235725.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Solanum lycopersicum] Length = 876 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F S+VVRREI+VRD E FHHFKDG C+CGDE Y Sbjct: 839 KFISEVVRREIAVRDTEQFHHFKDGRCTCGDENY 872 >ref|XP_006306315.1| hypothetical protein CARUB_v10012185mg [Capsella rubella] gi|482575026|gb|EOA39213.1| hypothetical protein CARUB_v10012185mg [Capsella rubella] Length = 866 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCG 92 +F SK VRREISVRDAEHFHHF+DG CSCG Sbjct: 836 KFISKTVRREISVRDAEHFHHFRDGECSCG 865 >emb|CBI36234.3| unnamed protein product [Vitis vinifera] Length = 906 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDE 98 +F SKVVRR ISVRD E FHHFKDG CSCGDE Sbjct: 835 KFISKVVRRGISVRDTEQFHHFKDGVCSCGDE 866 >ref|XP_006853748.1| hypothetical protein AMTR_s00056p00185560 [Amborella trichopoda] gi|548857409|gb|ERN15215.1| hypothetical protein AMTR_s00056p00185560 [Amborella trichopoda] Length = 796 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F + VV+REI+VRDA FHHF+DG CSCGD+GY Sbjct: 757 KFITSVVKREITVRDANDFHHFRDGFCSCGDQGY 790 >ref|XP_004506883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cicer arietinum] Length = 881 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +3 Query: 3 RFFSKVVRREISVRDAEHFHHFKDGTCSCGDEGY 104 +F SK VRREISVRDAE FH FK G CSC DEGY Sbjct: 848 KFISKEVRREISVRDAERFHRFKGGLCSCMDEGY 881