BLASTX nr result
ID: Catharanthus22_contig00026605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00026605 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004234234.1| PREDICTED: putative SWI/SNF-related matrix-a... 59 9e-07 >ref|XP_004234234.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Solanum lycopersicum] Length = 1120 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/71 (50%), Positives = 48/71 (67%) Frame = +3 Query: 66 VRPSIGSEMAESKIRKALFQCDDSPDAAIRYSLDKPDFILPPLTVKKTVTSTGASRVSML 245 +R IGSE+ E++I +AL Q +++P+AAI + LD PPL V+KTVTSTG R+S Sbjct: 15 IRSVIGSEIPENEILEALSQKNNNPEAAINHLLDSS----PPLIVQKTVTSTGV-RISAP 69 Query: 246 IDQENQHESDG 278 I QEN ES G Sbjct: 70 IKQENGEESLG 80