BLASTX nr result
ID: Catharanthus22_contig00026163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00026163 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulga... 60 3e-07 >emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1357 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/69 (37%), Positives = 43/69 (62%) Frame = -3 Query: 221 LWNLSEHPQVQNFV*RWCLKSIPTGAELGRRHILKGQ*EMLCPCCKAVVETYFHVLFSCQ 42 LW+L+ P+V++F+ R C S+P L RRH++ E CPCC ET FH+ + C Sbjct: 1042 LWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLID---EAGCPCCAREDETQFHLFYRCP 1098 Query: 41 LASQVWKQL 15 ++ ++W++L Sbjct: 1099 MSLKLWEEL 1107