BLASTX nr result
ID: Catharanthus22_contig00025950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00025950 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265876.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_006360648.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_006372218.1| hypothetical protein POPTR_0018s14360g [Popu... 63 3e-08 ref|XP_002331436.1| predicted protein [Populus trichocarpa] gi|5... 63 3e-08 ref|XP_006360650.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_002511816.1| pentatricopeptide repeat-containing protein,... 60 3e-07 ref|XP_004240282.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_002265876.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Vitis vinifera] gi|297736023|emb|CBI24061.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 72.4 bits (176), Expect = 6e-11 Identities = 43/106 (40%), Positives = 64/106 (60%) Frame = -1 Query: 318 PLCMKIPVSTFEATRFQLSCKRNGYDNRSFSPMRVWQAKQDGNGSSLGDNCMDCGWIAPG 139 PLC+ + + + RF++S +N NR+ + W KQ+ + DN +D + Sbjct: 9 PLCL---IGSHKTQRFRVSLHQNYSPNRALARKLFWHWKQERSVDGK-DNYVDYTPLIQA 64 Query: 138 LSRKCLPHEAEEFLLKIRSEGFGCDMSTLSALMLCYANSRLLSEAQ 1 LSRK LPH A+E L +++SEGF + STLSALMLCYA++ L +AQ Sbjct: 65 LSRKRLPHVAQELLFEMKSEGFLPNNSTLSALMLCYADNGLFPKAQ 110 >ref|XP_006360648.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X1 [Solanum tuberosum] gi|565389826|ref|XP_006360649.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X2 [Solanum tuberosum] Length = 416 Score = 71.2 bits (173), Expect = 1e-10 Identities = 40/81 (49%), Positives = 52/81 (64%) Frame = -1 Query: 246 YDNRSFSPMRVWQAKQDGNGSSLGDNCMDCGWIAPGLSRKCLPHEAEEFLLKIRSEGFGC 67 + N+S + R W+ KQ GN G N DC + GLSRK LP AE +L+++SEGF Sbjct: 23 HQNQSSAQKRRWRMKQGGNIDPRG-NYADCASLIQGLSRKKLPVAAERLVLEMKSEGFVP 81 Query: 66 DMSTLSALMLCYANSRLLSEA 4 D STLSALMLCYA++ L +A Sbjct: 82 DSSTLSALMLCYASNGLFYKA 102 >ref|XP_006372218.1| hypothetical protein POPTR_0018s14360g [Populus trichocarpa] gi|550318749|gb|ERP50015.1| hypothetical protein POPTR_0018s14360g [Populus trichocarpa] Length = 392 Score = 63.2 bits (152), Expect = 3e-08 Identities = 37/104 (35%), Positives = 56/104 (53%) Frame = -1 Query: 312 CMKIPVSTFEATRFQLSCKRNGYDNRSFSPMRVWQAKQDGNGSSLGDNCMDCGWIAPGLS 133 C + +++ RF + + R+ + + Q K+D G + C DC + L Sbjct: 12 CYANVIGSYKPKRFAIFSIKRDPKKRALAQKMIRQWKRD-QGVFGKETCADCASLIQTLC 70 Query: 132 RKCLPHEAEEFLLKIRSEGFGCDMSTLSALMLCYANSRLLSEAQ 1 + PH AEE LL+++ EGF D TLSA+MLCYA+S LL +AQ Sbjct: 71 KHRRPHLAEELLLELKCEGFLPDNRTLSAMMLCYADSGLLPQAQ 114 >ref|XP_002331436.1| predicted protein [Populus trichocarpa] gi|566215849|ref|XP_006372219.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550318750|gb|ERP50016.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 428 Score = 63.2 bits (152), Expect = 3e-08 Identities = 37/104 (35%), Positives = 56/104 (53%) Frame = -1 Query: 312 CMKIPVSTFEATRFQLSCKRNGYDNRSFSPMRVWQAKQDGNGSSLGDNCMDCGWIAPGLS 133 C + +++ RF + + R+ + + Q K+D G + C DC + L Sbjct: 12 CYANVIGSYKPKRFAIFSIKRDPKKRALAQKMIRQWKRD-QGVFGKETCADCASLIQTLC 70 Query: 132 RKCLPHEAEEFLLKIRSEGFGCDMSTLSALMLCYANSRLLSEAQ 1 + PH AEE LL+++ EGF D TLSA+MLCYA+S LL +AQ Sbjct: 71 KHRRPHLAEELLLELKCEGFLPDNRTLSAMMLCYADSGLLPQAQ 114 >ref|XP_006360650.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X3 [Solanum tuberosum] Length = 409 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/68 (51%), Positives = 45/68 (66%) Frame = -1 Query: 207 AKQDGNGSSLGDNCMDCGWIAPGLSRKCLPHEAEEFLLKIRSEGFGCDMSTLSALMLCYA 28 A++ GN G N DC + GLSRK LP AE +L+++SEGF D STLSALMLCYA Sbjct: 29 AQKGGNIDPRG-NYADCASLIQGLSRKKLPVAAERLVLEMKSEGFVPDSSTLSALMLCYA 87 Query: 27 NSRLLSEA 4 ++ L +A Sbjct: 88 SNGLFYKA 95 >ref|XP_002511816.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548996|gb|EEF50485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 427 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/92 (36%), Positives = 53/92 (57%) Frame = -1 Query: 276 RFQLSCKRNGYDNRSFSPMRVWQAKQDGNGSSLGDNCMDCGWIAPGLSRKCLPHEAEEFL 97 RF+L + NR + ++Q KQD S +DC + L K PH A+E L Sbjct: 26 RFRLFSSQRDPTNRPLARKIIYQWKQD---QSFSCKEVDCASLVQNLHSKRTPHLAQEIL 82 Query: 96 LKIRSEGFGCDMSTLSALMLCYANSRLLSEAQ 1 L+++S+G+ + TLSA++LCYA++ LL +AQ Sbjct: 83 LEMKSQGYVLNNPTLSAILLCYADNGLLPQAQ 114 >ref|XP_004240282.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Solanum lycopersicum] Length = 381 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = -1 Query: 171 NCMDCGWIAPGLSRKCLPHEAEEFLLKIRSEGFGCDMSTLSALMLCYANSRLLSEA 4 N DC + GLSRK LP AE +L+++SEGF D STLSALMLCYA + L +A Sbjct: 12 NYRDCASLIQGLSRKKLPVAAERLVLEMKSEGFVPDSSTLSALMLCYATNGLFCKA 67