BLASTX nr result
ID: Catharanthus22_contig00025032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00025032 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78089.1| hypothetical protein VITISV_042921 [Vitis vinifera] 57 3e-06 >emb|CAN78089.1| hypothetical protein VITISV_042921 [Vitis vinifera] Length = 1066 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 3/84 (3%) Frame = +2 Query: 2 IPQSTVKKRWTKQARCNLD---SDQALKRARQMLHLGVLSSMCSEMNYYASQATESFKGV 172 IP+S + KRW+K A+ + +++ A ++ G LSSMCS M+Y+ASQ+ + FK Sbjct: 840 IPESCIMKRWSKLAKETVQVHHDNESQGDATNIIRYGALSSMCSRMSYFASQSEKDFKEA 899 Query: 173 RNAIFKLSSRMMQISNAEADEPRK 244 R I +L+ +M ++ A+E + Sbjct: 900 RCEIQRLTCQMEELCKNSAEESER 923