BLASTX nr result
ID: Catharanthus22_contig00024469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00024469 (630 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134825.1| PREDICTED: phosphatidylinositide phosphatase... 56 1e-05 >ref|XP_004134825.1| PREDICTED: phosphatidylinositide phosphatase SAC1-A-like [Cucumis sativus] gi|449491249|ref|XP_004158840.1| PREDICTED: phosphatidylinositide phosphatase SAC1-A-like [Cucumis sativus] Length = 596 Score = 55.8 bits (133), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 154 FNNFQAAIGKDIVDITLIARRCTRRTGFKM 243 F NFQAAIGKDIVD+TLIARRCTRRTG ++ Sbjct: 202 FQNFQAAIGKDIVDVTLIARRCTRRTGTRL 231