BLASTX nr result
ID: Catharanthus22_contig00024385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00024385 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI98626.1| hypothetical protein 111O18.13 [Coffea canephora] 63 4e-08 >gb|AEI98626.1| hypothetical protein 111O18.13 [Coffea canephora] Length = 526 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/87 (40%), Positives = 49/87 (56%) Frame = +3 Query: 15 EVLDTPHQATGKDEADSKDGIYKNQTHAKHGTSFSWKPQVPVGSSATGIPENNRSNTSQN 194 +VLDT H A K+E +++D I+++Q+ H T WK Q PV S+ P + N +Q Sbjct: 384 DVLDTCHVAKNKEETENRDSIHRSQSLPMHRTPILWKSQPPVRSATVNTPADKIHNITQE 443 Query: 195 MEIDLENYPREESHTGPDGKTAGSSLR 275 M+ID PR S TG D K SS+R Sbjct: 444 MDID----PR--SQTGSDEKVVASSMR 464