BLASTX nr result
ID: Catharanthus22_contig00024372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00024372 (621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354770.1| PREDICTED: two-component response regulator-... 82 1e-13 gb|AFA35965.1| timing of cab expression 1/pseudo-response regula... 81 2e-13 ref|XP_004242175.1| PREDICTED: two-component response regulator-... 80 4e-13 ref|XP_006364578.1| PREDICTED: two-component response regulator-... 74 4e-11 ref|XP_004235983.1| PREDICTED: two-component response regulator-... 74 4e-11 ref|XP_004508722.1| PREDICTED: two-component response regulator-... 72 1e-10 ref|XP_004508721.1| PREDICTED: two-component response regulator-... 72 1e-10 ref|XP_004508720.1| PREDICTED: two-component response regulator-... 72 1e-10 ref|XP_006600701.1| PREDICTED: two-component response regulator-... 71 2e-10 ref|XP_006578567.1| PREDICTED: two-component response regulator-... 71 2e-10 gb|ESW27284.1| hypothetical protein PHAVU_003G188400g [Phaseolus... 71 2e-10 ref|XP_003523010.1| PREDICTED: two-component response regulator-... 71 2e-10 ref|XP_002514725.1| sensory transduction histidine kinase, putat... 71 2e-10 gb|EPS66801.1| hypothetical protein M569_07975, partial [Genlise... 71 3e-10 gb|AEA92684.1| TOC1 [Phaseolus vulgaris] 70 4e-10 gb|EOY21928.1| Sensory transduction histidine kinase, putative i... 70 6e-10 ref|XP_006579532.1| PREDICTED: two-component response regulator-... 69 8e-10 ref|XP_002330130.1| pseudo response regulator [Populus trichocar... 69 8e-10 ref|XP_004157464.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 69 1e-09 ref|XP_004137419.1| PREDICTED: two-component response regulator-... 69 1e-09 >ref|XP_006354770.1| PREDICTED: two-component response regulator-like APRR1-like [Solanum tuberosum] Length = 549 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 489 MEKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 MEK E +TG+GFIDRSKVRILLCDND+KSSEEVFTLLCKCSYQ Sbjct: 1 MEKNETVRTGDGFIDRSKVRILLCDNDAKSSEEVFTLLCKCSYQ 44 >gb|AFA35965.1| timing of cab expression 1/pseudo-response regulator 1 [Nicotiana attenuata] Length = 551 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 489 MEKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 MEK EI K+GEGFIDRSKVRILLCD D+KSS+EVFTLLCKCSYQ Sbjct: 1 MEKSEIVKSGEGFIDRSKVRILLCDKDAKSSQEVFTLLCKCSYQ 44 >ref|XP_004242175.1| PREDICTED: two-component response regulator-like APRR1-like [Solanum lycopersicum] Length = 545 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +3 Query: 486 LMEKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 +MEK E +TG+GFIDRSKVRILLCD+D+KSSEEVFTLLCKCSYQ Sbjct: 2 VMEKNETVRTGDGFIDRSKVRILLCDSDAKSSEEVFTLLCKCSYQ 46 >ref|XP_006364578.1| PREDICTED: two-component response regulator-like APRR1-like [Solanum tuberosum] Length = 552 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 486 LMEKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 +MEK +I K+G+GFIDRSKVRILLCD D SS+EV TLLCKCSYQ Sbjct: 1 MMEKNKIIKSGDGFIDRSKVRILLCDKDLSSSQEVLTLLCKCSYQ 45 >ref|XP_004235983.1| PREDICTED: two-component response regulator-like APRR1-like [Solanum lycopersicum] Length = 553 Score = 73.6 bits (179), Expect = 4e-11 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 486 LMEKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 +MEK +I K+G+GFIDRSKVRILLCD D SS+EV TLLCKCSYQ Sbjct: 1 MMEKNKIIKSGDGFIDRSKVRILLCDKDLSSSQEVLTLLCKCSYQ 45 >ref|XP_004508722.1| PREDICTED: two-component response regulator-like APRR1-like isoform X3 [Cicer arietinum] Length = 553 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVFTLL CSYQ Sbjct: 18 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFTLLVNCSYQ 58 >ref|XP_004508721.1| PREDICTED: two-component response regulator-like APRR1-like isoform X2 [Cicer arietinum] Length = 567 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVFTLL CSYQ Sbjct: 18 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFTLLVNCSYQ 58 >ref|XP_004508720.1| PREDICTED: two-component response regulator-like APRR1-like isoform X1 [Cicer arietinum] Length = 572 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVFTLL CSYQ Sbjct: 18 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFTLLVNCSYQ 58 >ref|XP_006600701.1| PREDICTED: two-component response regulator-like APRR1-like [Glycine max] Length = 579 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVFTLL CSYQ Sbjct: 22 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFTLLLGCSYQ 62 >ref|XP_006578567.1| PREDICTED: two-component response regulator-like APRR1-like isoform X2 [Glycine max] Length = 550 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/45 (75%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +3 Query: 489 MEKGEIGKTG-EGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 +E G GK+G +GF+DRSKVRILLCDNDSKSS+EVFTLL +CSYQ Sbjct: 11 IESGNNGKSGGDGFVDRSKVRILLCDNDSKSSQEVFTLLLRCSYQ 55 >gb|ESW27284.1| hypothetical protein PHAVU_003G188400g [Phaseolus vulgaris] Length = 559 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVFTLL CSYQ Sbjct: 22 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFTLLLGCSYQ 62 >ref|XP_003523010.1| PREDICTED: two-component response regulator-like APRR1-like isoform X1 [Glycine max] Length = 560 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/45 (75%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +3 Query: 489 MEKGEIGKTG-EGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 +E G GK+G +GF+DRSKVRILLCDNDSKSS+EVFTLL +CSYQ Sbjct: 11 IESGNNGKSGGDGFVDRSKVRILLCDNDSKSSQEVFTLLLRCSYQ 55 >ref|XP_002514725.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223546329|gb|EEF47831.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 550 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +3 Query: 492 EKGEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 E + G GEG IDRSKVRILLCDNDSKSSEEVFTLL KCSYQ Sbjct: 5 EPNKSGGGGEGLIDRSKVRILLCDNDSKSSEEVFTLLLKCSYQ 47 >gb|EPS66801.1| hypothetical protein M569_07975, partial [Genlisea aurea] Length = 265 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 513 TGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 + +GFIDRSKVRILLCDND KSSEEVFTLLCKCSYQ Sbjct: 1 SSDGFIDRSKVRILLCDNDEKSSEEVFTLLCKCSYQ 36 >gb|AEA92684.1| TOC1 [Phaseolus vulgaris] Length = 561 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G GK+G+GFIDRSKVRILLCDNDS SS+EVFTLL CSYQ Sbjct: 16 GNHGKSGDGFIDRSKVRILLCDNDSNSSQEVFTLLLGCSYQ 56 >gb|EOY21928.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] Length = 555 Score = 69.7 bits (169), Expect = 6e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 507 GKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G GEGFIDRSKVRILLCDND KSSEEVF+LL KCSYQ Sbjct: 16 GGAGEGFIDRSKVRILLCDNDPKSSEEVFSLLLKCSYQ 53 >ref|XP_006579532.1| PREDICTED: two-component response regulator-like APRR1-like [Glycine max] Length = 575 Score = 69.3 bits (168), Expect = 8e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 498 GEIGKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G K+G+GFIDRSKVRILLCDNDSKSSEEVF LL CSYQ Sbjct: 22 GNNSKSGDGFIDRSKVRILLCDNDSKSSEEVFALLLGCSYQ 62 >ref|XP_002330130.1| pseudo response regulator [Populus trichocarpa] gi|566206389|ref|XP_006374451.1| hypothetical protein POPTR_0015s07310g [Populus trichocarpa] gi|550322215|gb|ERP52248.1| hypothetical protein POPTR_0015s07310g [Populus trichocarpa] Length = 541 Score = 69.3 bits (168), Expect = 8e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 507 GKTGEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G G+GF+DRSKVRILLCDND+KSS+EVFTLL KCSYQ Sbjct: 13 GGAGDGFVDRSKVRILLCDNDAKSSQEVFTLLLKCSYQ 50 >ref|XP_004157464.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like APRR1-like [Cucumis sativus] Length = 557 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/42 (83%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 498 GEIGKT-GEGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G GK G+GFIDRSKVRILLCDNDSKSSEEVF LL KCSYQ Sbjct: 16 GSGGKNXGDGFIDRSKVRILLCDNDSKSSEEVFKLLLKCSYQ 57 >ref|XP_004137419.1| PREDICTED: two-component response regulator-like APRR1-like [Cucumis sativus] Length = 557 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/42 (83%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 498 GEIGKTG-EGFIDRSKVRILLCDNDSKSSEEVFTLLCKCSYQ 620 G GK G +GFIDRSKVRILLCDNDSKSSEEVF LL KCSYQ Sbjct: 16 GSGGKNGGDGFIDRSKVRILLCDNDSKSSEEVFKLLLKCSYQ 57