BLASTX nr result
ID: Catharanthus22_contig00024239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00024239 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64064.1| hypothetical protein VITISV_040909 [Vitis vinifera] 57 3e-06 >emb|CAN64064.1| hypothetical protein VITISV_040909 [Vitis vinifera] Length = 268 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -2 Query: 314 MKTYAIVLIVFGSVAAAILILCCLCNIGRKKKPTARPPQATLSAPRPNSYTDVESGQQQN 135 MK YAIVLI GSVA AI++LCCLC G K+K A +Y+D+E GQ Sbjct: 1 MKAYAIVLIACGSVAVAIVVLCCLCKGGGKRKLPAVQRSTAAPQSAQQTYSDMEKGQTSK 60 Query: 134 KS 129 S Sbjct: 61 SS 62