BLASTX nr result
ID: Catharanthus22_contig00024105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00024105 (218 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like... 59 5e-07 emb|CAN70851.1| hypothetical protein VITISV_030130 [Vitis vinifera] 59 5e-07 gb|EXC12979.1| RING-H2 finger protein ATL70 [Morus notabilis] 59 7e-07 ref|XP_006348447.1| PREDICTED: RING-H2 finger protein ATL70-like... 59 9e-07 ref|XP_004228913.1| PREDICTED: RING-H2 finger protein ATL70-like... 59 9e-07 ref|XP_002323373.2| zinc finger family protein [Populus trichoca... 58 1e-06 ref|XP_002524078.1| ring finger protein, putative [Ricinus commu... 58 1e-06 ref|XP_002308329.2| hypothetical protein POPTR_0006s21610g [Popu... 58 1e-06 ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein A... 58 1e-06 gb|EOY19298.1| RING/U-box superfamily protein [Theobroma cacao] 57 2e-06 gb|EMJ15947.1| hypothetical protein PRUPE_ppa024917mg [Prunus pe... 57 2e-06 ref|XP_006481618.1| PREDICTED: RING-H2 finger protein ATL70-like... 57 3e-06 ref|XP_006367022.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 ref|XP_006430043.1| hypothetical protein CICLE_v10013347mg [Citr... 57 3e-06 ref|XP_004236803.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 gb|EPS63693.1| hypothetical protein M569_11092, partial [Genlise... 57 3e-06 gb|EPS60936.1| hypothetical protein M569_13867, partial [Genlise... 57 3e-06 ref|XP_004981503.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 ref|XP_004161292.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 ref|XP_004136523.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 >ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like [Vitis vinifera] Length = 169 Score = 59.3 bits (142), Expect = 5e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CP+CR SPM Sbjct: 121 PDCGHLFHLKCVDPWLRLHPTCPVCRTSPM 150 >emb|CAN70851.1| hypothetical protein VITISV_030130 [Vitis vinifera] Length = 275 Score = 59.3 bits (142), Expect = 5e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CP+CR SPM Sbjct: 120 PDCGHLFHLKCVDPWLRLHPTCPVCRTSPM 149 >gb|EXC12979.1| RING-H2 finger protein ATL70 [Morus notabilis] Length = 173 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFHV+CVDPWLR+ +CP+CR SP+ Sbjct: 125 PDCGHLFHVKCVDPWLRLHPTCPVCRTSPI 154 >ref|XP_006348447.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum tuberosum] Length = 180 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CPICR SP+ Sbjct: 131 PDCGHLFHLKCVDPWLRLHPTCPICRTSPL 160 >ref|XP_004228913.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum lycopersicum] Length = 182 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CPICR SP+ Sbjct: 133 PDCGHLFHLKCVDPWLRLHPTCPICRTSPL 162 >ref|XP_002323373.2| zinc finger family protein [Populus trichocarpa] gi|550321005|gb|EEF05134.2| zinc finger family protein [Populus trichocarpa] Length = 167 Score = 58.2 bits (139), Expect = 1e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CP+CR SP+ Sbjct: 119 PDCGHLFHLKCVDPWLRLHPTCPVCRTSPL 148 >ref|XP_002524078.1| ring finger protein, putative [Ricinus communis] gi|223536646|gb|EEF38288.1| ring finger protein, putative [Ricinus communis] Length = 172 Score = 58.2 bits (139), Expect = 1e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CP+CR SP+ Sbjct: 124 PDCGHLFHLKCVDPWLRLHPTCPVCRNSPL 153 >ref|XP_002308329.2| hypothetical protein POPTR_0006s21610g [Populus trichocarpa] gi|550336808|gb|EEE91852.2| hypothetical protein POPTR_0006s21610g [Populus trichocarpa] Length = 167 Score = 57.8 bits (138), Expect = 1e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH+ CVDPWLR+ +CP+CR SP+ Sbjct: 119 PDCGHLFHLRCVDPWLRLHPTCPVCRTSPL 148 >ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Cucumis sativus] Length = 172 Score = 57.8 bits (138), Expect = 1e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH++CVDPWLR+ +CP+CR SP+ Sbjct: 124 PDCGHLFHLKCVDPWLRLHPTCPVCRTSPI 153 >gb|EOY19298.1| RING/U-box superfamily protein [Theobroma cacao] Length = 162 Score = 57.4 bits (137), Expect = 2e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGH+FH++CVDPWLR+ +CPICR SP+ Sbjct: 116 PDCGHIFHLKCVDPWLRLHPTCPICRNSPV 145 >gb|EMJ15947.1| hypothetical protein PRUPE_ppa024917mg [Prunus persica] Length = 170 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSP 132 P CGHLFH+ CVDPWLR++ +CPICR SP Sbjct: 122 PDCGHLFHLTCVDPWLRLRPTCPICRNSP 150 >ref|XP_006481618.1| PREDICTED: RING-H2 finger protein ATL70-like [Citrus sinensis] Length = 178 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P C HLFHV+CVDPWLR+ +CP+CR SP+ Sbjct: 130 PDCSHLFHVKCVDPWLRLHPTCPVCRTSPL 159 >ref|XP_006367022.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Solanum tuberosum] Length = 179 Score = 57.0 bits (136), Expect = 3e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -1 Query: 212 CGHLFHVECVDPWLRIQSSCPICRYSPM 129 CGH+FHV+C+DPWLR+ +CPICR SP+ Sbjct: 149 CGHIFHVKCIDPWLRLHPTCPICRNSPL 176 >ref|XP_006430043.1| hypothetical protein CICLE_v10013347mg [Citrus clementina] gi|557532100|gb|ESR43283.1| hypothetical protein CICLE_v10013347mg [Citrus clementina] Length = 177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P C HLFHV+CVDPWLR+ +CP+CR SP+ Sbjct: 129 PDCSHLFHVKCVDPWLRLHPTCPVCRTSPL 158 >ref|XP_004236803.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Solanum lycopersicum] Length = 186 Score = 57.0 bits (136), Expect = 3e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -1 Query: 212 CGHLFHVECVDPWLRIQSSCPICRYSPM 129 CGH+FHV+C+DPWLR+ +CPICR SP+ Sbjct: 156 CGHIFHVKCIDPWLRLHPTCPICRNSPL 183 >gb|EPS63693.1| hypothetical protein M569_11092, partial [Genlisea aurea] Length = 126 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSP 132 P CGH+FH ECVDPWL I ++CP+CR SP Sbjct: 93 PECGHVFHAECVDPWLLIHATCPVCRKSP 121 >gb|EPS60936.1| hypothetical protein M569_13867, partial [Genlisea aurea] Length = 140 Score = 56.6 bits (135), Expect = 3e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFHV C+DPWLR+ +CP+CR P+ Sbjct: 98 PKCGHLFHVTCIDPWLRLHPTCPVCRTPPL 127 >ref|XP_004981503.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Setaria italica] Length = 193 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH ECVDPWLR +CP+CR SP+ Sbjct: 143 PECGHLFHRECVDPWLRQHPTCPVCRTSPL 172 >ref|XP_004161292.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Cucumis sativus] Length = 162 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH C+DPWLR+ SCP+CR SP+ Sbjct: 114 PDCGHLFHCGCIDPWLRLNPSCPVCRTSPV 143 >ref|XP_004136523.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Cucumis sativus] Length = 162 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -1 Query: 218 PYCGHLFHVECVDPWLRIQSSCPICRYSPM 129 P CGHLFH C+DPWLR+ SCP+CR SP+ Sbjct: 114 PDCGHLFHCGCIDPWLRLNPSCPVCRTSPV 143