BLASTX nr result
ID: Catharanthus22_contig00023869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00023869 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 51 3e-07 gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus... 57 3e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 51.2 bits (121), Expect(2) = 3e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 249 QHRLVILPLQRAGGFRCSVKPASRIALHSKDRV 151 +H+LVILPL RAGG RCSVKPASR AL S+++V Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQV 48 Score = 28.9 bits (63), Expect(2) = 3e-07 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 101 SGKPGRKLSRTQPAKPVQCPNTLMPPLGLQAHA 3 +G+ + + +P P Q P TLMP L LQAHA Sbjct: 64 NGRARAQPHQGRPTGPEQRPITLMPLLRLQAHA 96 >gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/79 (45%), Positives = 42/79 (53%) Frame = -3 Query: 237 VILPLQRAGGFRCSVKPASRIALHSKDRVXXXXXXXXXXXXXXAWIGQAW*KAESNPTS* 58 VILPL GG RCSVKPASR ALHSK + +G+ + +PT Sbjct: 5 VILPLLGMGGGRCSVKPASRCALHSKSQ-ETLAFTKVPRLNSQLGVGRPT-NCKHSPTQQ 62 Query: 57 ASSMSQHLNAPTWVTSSRN 1 AS + H NAPTWVTS N Sbjct: 63 ASMLFHHSNAPTWVTSWSN 81