BLASTX nr result
ID: Catharanthus22_contig00023809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00023809 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343315.1| PREDICTED: uncharacterized transporter YBR28... 63 5e-08 ref|XP_004234500.1| PREDICTED: uncharacterized transporter YBR28... 62 6e-08 ref|XP_006350447.1| PREDICTED: uncharacterized transporter YBR28... 59 9e-07 ref|XP_002303498.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_002317634.2| hypothetical protein POPTR_0011s14870g [Popu... 58 1e-06 ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus ... 57 3e-06 ref|XP_006370751.1| hypothetical protein POPTR_0001s46060g [Popu... 56 4e-06 ref|XP_006370750.1| hypothetical protein POPTR_0001s46060g [Popu... 56 4e-06 ref|XP_006370747.1| hypothetical protein POPTR_0001s46060g [Popu... 56 4e-06 ref|XP_002300540.1| predicted protein [Populus trichocarpa] 56 4e-06 >ref|XP_006343315.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 415 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 M I ELF++ALMPV+KTLLIA+VG++LA+D SIL + R+HLNN Sbjct: 1 MNIQELFLLALMPVLKTLLIAVVGLYLALDHVSILTAEGRHHLNN 45 >ref|XP_004234500.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] Length = 415 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 M I+ELF +ALMPV+KTLLIA+VG++LA+D SIL + R+HLNN Sbjct: 1 MNIEELFFLALMPVLKTLLIAVVGLYLAMDHVSILTAEGRHHLNN 45 >ref|XP_006350447.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 396 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 M ELF+VAL+PV+KTL+I VG+FLA++R ++L S AR+HLNN Sbjct: 1 MAFVELFVVALVPVLKTLIITAVGLFLALERINLLGSTARHHLNN 45 >ref|XP_002303498.1| predicted protein [Populus trichocarpa] Length = 370 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 M I +LF VALMPV+K LL+ VGVFLAI+R IL + ARNHLNN Sbjct: 1 MDIWKLFFVALMPVLKVLLLTAVGVFLAIERVGILGADARNHLNN 45 >ref|XP_002317634.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa] gi|550328421|gb|EEE98246.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa] Length = 390 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG+ +LF+VALMPVVK LLI VGVFLA +R IL + AR HLN+ Sbjct: 1 MGLWQLFVVALMPVVKVLLITAVGVFLATERMDILGTDARKHLNS 45 >ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534189|gb|EEF35905.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 434 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG +LF+VALMPV+K LL+ +G+FLA D +L ++ARNHLNN Sbjct: 33 MGFWDLFVVALMPVLKVLLVTAIGLFLATDGIHLLGASARNHLNN 77 >ref|XP_006370751.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|550349996|gb|ERP67320.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] Length = 376 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG +LF+VA++PV+K LLI +VG+FLA+DR +L S AR +LNN Sbjct: 1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNN 45 >ref|XP_006370750.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|550349995|gb|ERP67319.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] Length = 406 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG +LF+VA++PV+K LLI +VG+FLA+DR +L S AR +LNN Sbjct: 1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNN 45 >ref|XP_006370747.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|566155154|ref|XP_006370748.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|566155156|ref|XP_006370749.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|550349992|gb|ERP67316.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|550349993|gb|ERP67317.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] gi|550349994|gb|ERP67318.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa] Length = 405 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG +LF+VA++PV+K LLI +VG+FLA+DR +L S AR +LNN Sbjct: 1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNN 45 >ref|XP_002300540.1| predicted protein [Populus trichocarpa] Length = 374 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 135 MGIDELFIVALMPVVKTLLIAIVGVFLAIDRFSILCSAARNHLNN 1 MG +LF+VA++PV+K LLI +VG+FLA+DR +L S AR +LNN Sbjct: 1 MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNN 45