BLASTX nr result
ID: Catharanthus22_contig00022513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00022513 (473 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432164.1| hypothetical protein CICLE_v10002244mg [Citr... 67 2e-09 ref|XP_006351753.1| PREDICTED: uncharacterized protein LOC102599... 60 4e-07 ref|XP_004230583.1| PREDICTED: uncharacterized protein LOC101255... 58 1e-06 ref|XP_002307037.2| hypothetical protein POPTR_0005s06600g [Popu... 55 7e-06 >ref|XP_006432164.1| hypothetical protein CICLE_v10002244mg [Citrus clementina] gi|567879213|ref|XP_006432165.1| hypothetical protein CICLE_v10002244mg [Citrus clementina] gi|568821177|ref|XP_006465066.1| PREDICTED: uncharacterized protein LOC102630478 isoform X1 [Citrus sinensis] gi|557534286|gb|ESR45404.1| hypothetical protein CICLE_v10002244mg [Citrus clementina] gi|557534287|gb|ESR45405.1| hypothetical protein CICLE_v10002244mg [Citrus clementina] Length = 253 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 467 SQDSPDKRAVQIPASTKTSNRVVPAYRRAKVRGVLLKDTEDD 342 SQDSPDK+A Q P ++K +NRV+PA+RRAKVRG LL+DTEDD Sbjct: 209 SQDSPDKQAAQSPVASKVANRVIPAHRRAKVRGALLQDTEDD 250 >ref|XP_006351753.1| PREDICTED: uncharacterized protein LOC102599500 isoform X1 [Solanum tuberosum] Length = 251 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -1 Query: 470 TSQDSPDKRAVQIPASTKTSNRVVPAYRRAKVRGVLLKDTEDDPQD 333 +S +SP K+A Q+P STK +NRVVPA+RRA+VRGVLL DTE++ QD Sbjct: 207 SSLESPVKQAAQLP-STKVTNRVVPAHRRARVRGVLLHDTEEERQD 251 >ref|XP_004230583.1| PREDICTED: uncharacterized protein LOC101255339 isoform 1 [Solanum lycopersicum] gi|460369468|ref|XP_004230584.1| PREDICTED: uncharacterized protein LOC101255339 isoform 2 [Solanum lycopersicum] Length = 250 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 458 SPDKRAVQIPASTKTSNRVVPAYRRAKVRGVLLKDTEDDPQD 333 SP K+A Q+P STK +NRVVPA+RRA+VRGVLL DTE++ QD Sbjct: 210 SPVKQAAQLP-STKVTNRVVPAHRRARVRGVLLHDTEEERQD 250 >ref|XP_002307037.2| hypothetical protein POPTR_0005s06600g [Populus trichocarpa] gi|550338263|gb|EEE94033.2| hypothetical protein POPTR_0005s06600g [Populus trichocarpa] Length = 297 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 452 DKRAVQIPASTKTSNRVVPAYRRAKVRGVLLKDTEDD 342 DK A + PASTK +NRVVPA+RRAKVRG LL+D EDD Sbjct: 258 DKLAGRDPASTKVTNRVVPAFRRAKVRGALLQDIEDD 294