BLASTX nr result
ID: Catharanthus22_contig00022418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00022418 (697 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301548.1| PREDICTED: uncharacterized protein LOC101301... 64 5e-08 emb|CBI28115.3| unnamed protein product [Vitis vinifera] 58 3e-06 ref|XP_002281524.1| PREDICTED: uncharacterized protein LOC100245... 58 3e-06 ref|XP_002515571.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 gb|EMJ05827.1| hypothetical protein PRUPE_ppa002148mg [Prunus pe... 57 7e-06 >ref|XP_004301548.1| PREDICTED: uncharacterized protein LOC101301592 [Fragaria vesca subsp. vesca] Length = 701 Score = 63.9 bits (154), Expect = 5e-08 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 696 VVSKRDELLLSEKIERLKRKIYGFVIQHVGTTVENSTPTNSS 571 VVSKRD+LL +EK++RLKRKIYGFVIQHVGTT +NS+P SS Sbjct: 661 VVSKRDDLL-NEKVDRLKRKIYGFVIQHVGTTFDNSSPRASS 701 >emb|CBI28115.3| unnamed protein product [Vitis vinifera] Length = 662 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 696 VVSKRDELLLSEKIERLKRKIYGFVIQHVGTTVENSTPTNSS 571 V SK+DELL +EKIERLKRKIYGFVI HVGT+++NS+ SS Sbjct: 617 VASKQDELL-TEKIERLKRKIYGFVIHHVGTSLDNSSSIPSS 657 >ref|XP_002281524.1| PREDICTED: uncharacterized protein LOC100245597 [Vitis vinifera] Length = 710 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 696 VVSKRDELLLSEKIERLKRKIYGFVIQHVGTTVENSTPTNSS 571 V SK+DELL +EKIERLKRKIYGFVI HVGT+++NS+ SS Sbjct: 665 VASKQDELL-TEKIERLKRKIYGFVIHHVGTSLDNSSSIPSS 705 >ref|XP_002515571.1| conserved hypothetical protein [Ricinus communis] gi|223545515|gb|EEF47020.1| conserved hypothetical protein [Ricinus communis] Length = 684 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 696 VVSKRDELLLSEKIERLKRKIYGFVIQHVGTTVENSTPTNSS 571 +VSK DELL+ +KIE+LKRKIYGFVIQHVGT +NS+ SS Sbjct: 644 IVSKNDELLV-QKIEKLKRKIYGFVIQHVGTAFDNSSQVASS 684 >gb|EMJ05827.1| hypothetical protein PRUPE_ppa002148mg [Prunus persica] Length = 709 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 696 VVSKRDELLLSEKIERLKRKIYGFVIQHVGTTVENSTPTNS 574 VVSKRDE + +EKI+RLKRKIYGFVIQHVGTT +N+ +S Sbjct: 670 VVSKRDEQI-NEKIDRLKRKIYGFVIQHVGTTFDNAPLASS 709