BLASTX nr result
ID: Catharanthus22_contig00022239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00022239 (296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352514.1| PREDICTED: splicing factor, suppressor of wh... 55 7e-06 ref|XP_006352513.1| PREDICTED: splicing factor, suppressor of wh... 55 7e-06 ref|XP_006352512.1| PREDICTED: splicing factor, suppressor of wh... 55 7e-06 ref|XP_004248293.1| PREDICTED: uncharacterized protein LOC101250... 55 7e-06 >ref|XP_006352514.1| PREDICTED: splicing factor, suppressor of white-apricot homolog isoform X3 [Solanum tuberosum] Length = 837 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 ETSMDNTVTHPRAPSLPSQTTEVSDDLRAKIRAMLMATR 118 E S+D + + RAPS PS++TE+SDDLRAKIRAMLMATR Sbjct: 798 EASVDVSSSQQRAPSQPSESTEISDDLRAKIRAMLMATR 836 >ref|XP_006352513.1| PREDICTED: splicing factor, suppressor of white-apricot homolog isoform X2 [Solanum tuberosum] Length = 842 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 ETSMDNTVTHPRAPSLPSQTTEVSDDLRAKIRAMLMATR 118 E S+D + + RAPS PS++TE+SDDLRAKIRAMLMATR Sbjct: 803 EASVDVSSSQQRAPSQPSESTEISDDLRAKIRAMLMATR 841 >ref|XP_006352512.1| PREDICTED: splicing factor, suppressor of white-apricot homolog isoform X1 [Solanum tuberosum] Length = 971 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 ETSMDNTVTHPRAPSLPSQTTEVSDDLRAKIRAMLMATR 118 E S+D + + RAPS PS++TE+SDDLRAKIRAMLMATR Sbjct: 932 EASVDVSSSQQRAPSQPSESTEISDDLRAKIRAMLMATR 970 >ref|XP_004248293.1| PREDICTED: uncharacterized protein LOC101250744 [Solanum lycopersicum] Length = 972 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 ETSMDNTVTHPRAPSLPSQTTEVSDDLRAKIRAMLMATR 118 E S+D + + RAPS PS++TE+SDDLRAKIRAMLMATR Sbjct: 933 EASVDVSSSQQRAPSQPSESTEISDDLRAKIRAMLMATR 971