BLASTX nr result
ID: Catharanthus22_contig00022031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00022031 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008081323.1| ribosomal protein S15 (chloroplast) [Cathara... 131 8e-29 gb|ADD30057.1| ribosomal protein S15 [Nerium oleander] 130 2e-28 gb|AGW04342.1| ribosomal protein S15 [Secamone afzelii] 128 9e-28 gb|AGW04953.1| ribosomal protein S15 [Telosma cordata] 125 4e-27 gb|AGW04645.1| ribosomal protein S15 [Marsdenia astephanoides] 125 4e-27 ref|YP_008963749.1| ribosomal protein S15 (chloroplast) [Liquida... 125 6e-27 ref|YP_817539.1| ribosomal protein S15 [Coffea arabica] gi|12215... 125 6e-27 gb|AGW04496.1| ribosomal protein S15 [Astephanus triflorus] 125 8e-27 gb|AGW04799.1| ribosomal protein S15 [Orthosia scoparia] 124 1e-26 gb|AGW05030.1| ribosomal protein S15 [Vincetoxicum rossicum] 124 2e-26 ref|YP_006666087.1| ribosomal protein S15 (chloroplast) [Capsicu... 124 2e-26 ref|YP_006503849.1| ribosomal protein S15 (chloroplast) [Datura ... 123 2e-26 gb|ADD30060.1| ribosomal protein S15 [Berberidopsis corallina] 123 2e-26 gb|AGW04876.1| ribosomal protein S15 [Sisyranthus trichostomus] 123 3e-26 gb|AGW04419.1| ribosomal protein S15 [Araujia sericifera] 123 3e-26 ref|NP_054564.1| ribosomal protein S15 [Nicotiana tabacum] gi|78... 122 4e-26 gb|AGW04722.1| ribosomal protein S15 [Matelea biflora] 122 4e-26 ref|YP_008563146.1| ribosomal protein S15 (chloroplast) [Solanum... 122 4e-26 gb|AGW04568.1| ribosomal protein S15 [Eustegia minuta] 122 5e-26 gb|AER52633.1| ribosomal protein S15 [Asclepias coulteri] gi|355... 121 8e-26 >ref|YP_008081323.1| ribosomal protein S15 (chloroplast) [Catharanthus roseus] gi|474452134|gb|AGI51202.1| ribosomal protein S15 (chloroplast) [Catharanthus roseus] Length = 87 Score = 131 bits (330), Expect = 8e-29 Identities = 67/68 (98%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKNAFISVISEEEKRGAVEFQVF FTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNAFISVISEEEKRGAVEFQVFRFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|ADD30057.1| ribosomal protein S15 [Nerium oleander] Length = 87 Score = 130 bits (326), Expect = 2e-28 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKNAFISVISEEEKRG+VEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNAFISVISEEEKRGSVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL KKN Sbjct: 61 LAYLDKKN 68 >gb|AGW04342.1| ribosomal protein S15 [Secamone afzelii] Length = 87 Score = 128 bits (321), Expect = 9e-28 Identities = 64/68 (94%), Positives = 68/68 (100%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKNAFISVISE+E+RG+VEFQVFSFTNKI+RLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNAFISVISEKERRGSVEFQVFSFTNKIQRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW04953.1| ribosomal protein S15 [Telosma cordata] Length = 87 Score = 125 bits (315), Expect = 4e-27 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW04645.1| ribosomal protein S15 [Marsdenia astephanoides] Length = 87 Score = 125 bits (315), Expect = 4e-27 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >ref|YP_008963749.1| ribosomal protein S15 (chloroplast) [Liquidambar formosana] gi|290487366|gb|ADD30067.1| ribosomal protein S15 [Liquidambar styraciflua] gi|491650428|gb|AGL13488.1| ribosomal protein S15 (chloroplast) [Liquidambar formosana] Length = 87 Score = 125 bits (314), Expect = 6e-27 Identities = 61/68 (89%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 M+KNAFISVIS+EE RG+VEFQVFSFTNKIRRLTSHLE+H+KDYLSQRGLRKILGKRQRL Sbjct: 1 MIKNAFISVISQEENRGSVEFQVFSFTNKIRRLTSHLELHRKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL+KKN Sbjct: 61 LAYLSKKN 68 >ref|YP_817539.1| ribosomal protein S15 [Coffea arabica] gi|122153676|sp|A0A392.1|RR15_COFAR RecName: Full=30S ribosomal protein S15, chloroplastic gi|116242221|gb|ABJ89736.1| ribosomal protein S15 [Coffea arabica] Length = 87 Score = 125 bits (314), Expect = 6e-27 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN ISVISEEEKRG+VEFQVF FTNKIRRLTSHLE+HKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNTLISVISEEEKRGSVEFQVFRFTNKIRRLTSHLELHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW04496.1| ribosomal protein S15 [Astephanus triflorus] Length = 87 Score = 125 bits (313), Expect = 8e-27 Identities = 63/68 (92%), Positives = 66/68 (97%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+EKRG+VEFQVF FTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKEKRGSVEFQVFRFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL KKN Sbjct: 61 LAYLEKKN 68 >gb|AGW04799.1| ribosomal protein S15 [Orthosia scoparia] Length = 89 Score = 124 bits (312), Expect = 1e-26 Identities = 62/68 (91%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISEEE+RG+VEFQVF F+NKIR+LTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEEERRGSVEFQVFRFSNKIRKLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW05030.1| ribosomal protein S15 [Vincetoxicum rossicum] Length = 89 Score = 124 bits (310), Expect = 2e-26 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL KKN Sbjct: 61 LAYLEKKN 68 >ref|YP_006666087.1| ribosomal protein S15 (chloroplast) [Capsicum annuum] gi|401065989|gb|AFP90833.1| ribosomal protein S15 (chloroplast) [Capsicum annuum] Length = 87 Score = 124 bits (310), Expect = 2e-26 Identities = 61/68 (89%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN+ ISVIS+EEKRG+VEFQVF+FTNKIRRLTSHLE+HKKDYLSQRGL+KILGKRQRL Sbjct: 1 MVKNSVISVISQEEKRGSVEFQVFNFTNKIRRLTSHLELHKKDYLSQRGLKKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >ref|YP_006503849.1| ribosomal protein S15 (chloroplast) [Datura stramonium] gi|350996570|gb|AEQ37081.1| ribosomal protein S15 [Datura stramonium] Length = 87 Score = 123 bits (309), Expect = 2e-26 Identities = 60/68 (88%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN+ ISVIS+EEKRG++EFQVF+FTNKIRRLTSHLE+HKKDYLSQRGL+KILGKRQRL Sbjct: 1 MVKNSVISVISQEEKRGSIEFQVFNFTNKIRRLTSHLELHKKDYLSQRGLKKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|ADD30060.1| ribosomal protein S15 [Berberidopsis corallina] Length = 87 Score = 123 bits (309), Expect = 2e-26 Identities = 60/68 (88%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN+FISVIS+EE RG+VEFQVFSFTNKIR+LTSHLE+H+KDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNSFISVISQEENRGSVEFQVFSFTNKIRKLTSHLELHRKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL+KKN Sbjct: 61 LAYLSKKN 68 >gb|AGW04876.1| ribosomal protein S15 [Sisyranthus trichostomus] Length = 87 Score = 123 bits (308), Expect = 3e-26 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKIR LTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFCFTNKIRGLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW04419.1| ribosomal protein S15 [Araujia sericifera] Length = 89 Score = 123 bits (308), Expect = 3e-26 Identities = 61/68 (89%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF F+NKIR+LTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFSNKIRKLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >ref|NP_054564.1| ribosomal protein S15 [Nicotiana tabacum] gi|78102605|ref|YP_358744.1| ribosomal protein S15 [Nicotiana sylvestris] gi|81301635|ref|YP_398930.1| ribosomal protein S15 [Nicotiana tomentosiformis] gi|351653947|ref|YP_004891673.1| rps15 gene product (chloroplast) [Nicotiana undulata] gi|133801|sp|P06373.1|RR15_TOBAC RecName: Full=30S ribosomal protein S15, chloroplastic gi|85701226|sp|Q3C1P7.1|RR15_NICSY RecName: Full=30S ribosomal protein S15, chloroplastic gi|85701227|sp|Q33BW5.1|RR15_NICTO RecName: Full=30S ribosomal protein S15, chloroplastic gi|1223675|emb|CAA77399.1| ribosomal protein S15 [Nicotiana tabacum] gi|77799632|dbj|BAE46721.1| ribosomal protein S15 [Nicotiana sylvestris] gi|80750994|dbj|BAE48070.1| ribosomal protein S15 [Nicotiana tomentosiformis] gi|347453973|gb|AEO95631.1| ribosomal protein S15 (chloroplast) [Nicotiana undulata] gi|347454083|gb|AEO95740.1| ribosomal protein S15 [synthetic construct] gi|225263|prf||1211235CY ribosomal protein S15 Length = 87 Score = 122 bits (307), Expect = 4e-26 Identities = 60/68 (88%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN+ ISVIS+EEKRG+VEFQVF+FTNKIRRLTSHLE+HKKDYLSQRGL+KILGKRQRL Sbjct: 1 MVKNSVISVISQEEKRGSVEFQVFNFTNKIRRLTSHLELHKKDYLSQRGLKKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL+KKN Sbjct: 61 LAYLSKKN 68 >gb|AGW04722.1| ribosomal protein S15 [Matelea biflora] Length = 95 Score = 122 bits (307), Expect = 4e-26 Identities = 61/68 (89%), Positives = 66/68 (97%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKNAFISVISE+E+ G+VEFQVF F+NKIR+LTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKNAFISVISEKERSGSVEFQVFRFSNKIRKLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >ref|YP_008563146.1| ribosomal protein S15 (chloroplast) [Solanum lycopersicum] gi|544170730|ref|AP_004986.1| ribosomal protein S15 (chloroplast) [Solanum lycopersicum] gi|118595717|sp|Q2MI43.1|RR15_SOLLC RecName: Full=30S ribosomal protein S15, chloroplastic gi|84372041|gb|ABC56358.1| ribosomal protein S15 (chloroplast) [Solanum lycopersicum] gi|89241729|emb|CAJ32452.1| ribosomal protein S15 [Solanum lycopersicum] Length = 87 Score = 122 bits (307), Expect = 4e-26 Identities = 60/68 (88%), Positives = 67/68 (98%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVKN+ ISVIS+EEK+G+VEFQVF+FTNKIRRLTSHLE+HKKDYLSQRGL+KILGKRQRL Sbjct: 1 MVKNSVISVISQEEKKGSVEFQVFNFTNKIRRLTSHLELHKKDYLSQRGLKKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYLAKKN Sbjct: 61 LAYLAKKN 68 >gb|AGW04568.1| ribosomal protein S15 [Eustegia minuta] Length = 87 Score = 122 bits (306), Expect = 5e-26 Identities = 61/68 (89%), Positives = 66/68 (97%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKI+RLTSHLEVHKKDYLSQRGLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFTNKIQRLTSHLEVHKKDYLSQRGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL KKN Sbjct: 61 LAYLEKKN 68 >gb|AER52633.1| ribosomal protein S15 [Asclepias coulteri] gi|355332276|gb|AER52959.1| ribosomal protein S15 [Asclepias macrotis] gi|355332355|gb|AER53037.1| ribosomal protein S15 [Asclepias macrotis] Length = 89 Score = 121 bits (304), Expect = 8e-26 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = -2 Query: 204 MVKNAFISVISEEEKRGAVEFQVFSFTNKIRRLTSHLEVHKKDYLSQRGLRKILGKRQRL 25 MVK+AFISVISE+E+RG+VEFQVF FTNKIRRLTSHLEVHKKDYLSQ GLRKILGKRQRL Sbjct: 1 MVKSAFISVISEKERRGSVEFQVFRFTNKIRRLTSHLEVHKKDYLSQTGLRKILGKRQRL 60 Query: 24 LAYLAKKN 1 LAYL KKN Sbjct: 61 LAYLEKKN 68