BLASTX nr result
ID: Catharanthus22_contig00021963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021963 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275411.2| PREDICTED: tRNA-dihydrouridine synthase 3-li... 56 6e-06 >ref|XP_002275411.2| PREDICTED: tRNA-dihydrouridine synthase 3-like [Vitis vinifera] gi|297744713|emb|CBI37975.3| unnamed protein product [Vitis vinifera] Length = 678 Score = 55.8 bits (133), Expect = 6e-06 Identities = 40/95 (42%), Positives = 55/95 (57%), Gaps = 6/95 (6%) Frame = -1 Query: 269 LKLLGLVGK----MKNFEDKDNDDQPVANGSDVDRDNGNAEAIVVGSSNEVECCSQELAD 102 LKLLGL+GK +K FEDK D V+NG+ DN E +V+ S N+VE S ++ + Sbjct: 188 LKLLGLLGKANSKIKTFEDKGEGDLKVSNGTHATNDNSCGE-LVIDSDNKVE-GSPKMPE 245 Query: 101 DKPDDTDVF--DESRPIKKAKSSNDEAFGSGEIIN 3 + DD + F DE RP KK KS+ +E +G N Sbjct: 246 E--DDVEGFATDEPRPTKKIKSATNEECCTGNADN 278