BLASTX nr result
ID: Catharanthus22_contig00021850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021850 (555 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246446.1| PREDICTED: uncharacterized protein LOC101259... 40 7e-07 >ref|XP_004246446.1| PREDICTED: uncharacterized protein LOC101259474 [Solanum lycopersicum] Length = 214 Score = 39.7 bits (91), Expect(2) = 7e-07 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = -3 Query: 412 NRRKGKNYELEEVVSVNQSVYCGLLYYITFKAKAASDNGDLVTFQAK 272 N G YE++ +V VN+ G +YYITF K NGD FQAK Sbjct: 146 NTDNGTKYEVDRIVKVNEGGCQGFVYYITFTVK----NGDSEYFQAK 188 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 555 QIRKSRGFDIKDFPGVCELTGFVPV 481 QIR+S GFDIKD+PG C LT P+ Sbjct: 97 QIRESEGFDIKDYPGSCPLTSIYPM 121