BLASTX nr result
ID: Catharanthus22_contig00021781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021781 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006661572.1| PREDICTED: uncharacterized protein LOC102719... 56 6e-06 gb|EMT01333.1| Protein neuralized [Aegilops tauschii] 56 6e-06 ref|XP_003576880.1| PREDICTED: uncharacterized protein LOC100827... 56 6e-06 dbj|BAK07030.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 gb|EEE70273.1| hypothetical protein OsJ_30420 [Oryza sativa Japo... 56 6e-06 gb|EEC85096.1| hypothetical protein OsI_32468 [Oryza sativa Indi... 56 6e-06 dbj|BAG91347.1| unnamed protein product [Oryza sativa Japonica G... 56 6e-06 ref|NP_001063987.1| Os09g0570500 [Oryza sativa Japonica Group] g... 56 6e-06 ref|XP_004954453.1| PREDICTED: uncharacterized protein LOC101769... 55 7e-06 ref|XP_004954452.1| PREDICTED: uncharacterized protein LOC101769... 55 7e-06 gb|EMT14048.1| hypothetical protein F775_12628 [Aegilops tauschii] 55 7e-06 gb|EMS45542.1| hypothetical protein TRIUR3_35473 [Triticum urartu] 55 7e-06 gb|AFW63932.1| hypothetical protein ZEAMMB73_024114 [Zea mays] 55 7e-06 dbj|BAJ94141.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 ref|XP_002453073.1| hypothetical protein SORBIDRAFT_04g037810 [S... 55 7e-06 >ref|XP_006661572.1| PREDICTED: uncharacterized protein LOC102719423 [Oryza brachyantha] Length = 600 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 567 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 598 >gb|EMT01333.1| Protein neuralized [Aegilops tauschii] Length = 1071 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 483 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 514 >ref|XP_003576880.1| PREDICTED: uncharacterized protein LOC100827814 [Brachypodium distachyon] Length = 696 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 663 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 694 >dbj|BAK07030.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 699 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 666 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 697 >gb|EEE70273.1| hypothetical protein OsJ_30420 [Oryza sativa Japonica Group] Length = 658 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 625 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 656 >gb|EEC85096.1| hypothetical protein OsI_32468 [Oryza sativa Indica Group] Length = 658 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 625 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 656 >dbj|BAG91347.1| unnamed protein product [Oryza sativa Japonica Group] Length = 117 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 84 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 115 >ref|NP_001063987.1| Os09g0570500 [Oryza sativa Japonica Group] gi|113632220|dbj|BAF25901.1| Os09g0570500, partial [Oryza sativa Japonica Group] Length = 451 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHASY 256 C CS+CA +LVRSGGKCPLCR PI+E+I A + Sbjct: 418 CTCSKCANELVRSGGKCPLCRAPIIEVIRAYF 449 >ref|XP_004954453.1| PREDICTED: uncharacterized protein LOC101769254 isoform X2 [Setaria italica] Length = 738 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 705 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 734 >ref|XP_004954452.1| PREDICTED: uncharacterized protein LOC101769254 isoform X1 [Setaria italica] Length = 744 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 711 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 740 >gb|EMT14048.1| hypothetical protein F775_12628 [Aegilops tauschii] Length = 581 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 548 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 577 >gb|EMS45542.1| hypothetical protein TRIUR3_35473 [Triticum urartu] Length = 549 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 516 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 545 >gb|AFW63932.1| hypothetical protein ZEAMMB73_024114 [Zea mays] Length = 760 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 727 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 756 >dbj|BAJ94141.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 771 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 738 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 767 >ref|XP_002453073.1| hypothetical protein SORBIDRAFT_04g037810 [Sorghum bicolor] gi|241932904|gb|EES06049.1| hypothetical protein SORBIDRAFT_04g037810 [Sorghum bicolor] Length = 763 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 351 CYCSRCATDLVRSGGKCPLCREPIVELIHA 262 C CS+CA +LVRSGGKCPLCR PIVE++ A Sbjct: 730 CTCSKCANELVRSGGKCPLCRAPIVEVVRA 759