BLASTX nr result
ID: Catharanthus22_contig00021560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021560 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52708.1| hypothetical protein L484_022485 [Morus notabilis] 55 1e-05 >gb|EXB52708.1| hypothetical protein L484_022485 [Morus notabilis] Length = 299 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 SFDNQSRREIVKAPARSKSVLSAFFVKEKTSKLMS 106 SFDNQ+RREIV+ P RSKSVLSAFFVK+KT K S Sbjct: 256 SFDNQNRREIVRVPVRSKSVLSAFFVKQKTLKAES 290