BLASTX nr result
ID: Catharanthus22_contig00021458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021458 (614 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345292.1| PREDICTED: O-acyltransferase WSD1-like [Sola... 57 4e-06 ref|XP_004228362.1| PREDICTED: O-acyltransferase WSD1-like [Sola... 56 9e-06 >ref|XP_006345292.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum] Length = 655 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 78 EGKKDVGATEKNN-LPKNIRLRSTLLINLRPTAGIQ 182 EGKKD GA EKNN LPKNIRLRS++L+NLRP+ GIQ Sbjct: 303 EGKKDKGAIEKNNNLPKNIRLRSSILVNLRPSVGIQ 338 >ref|XP_004228362.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum] Length = 506 Score = 55.8 bits (133), Expect = 9e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 78 EGKKDVGATEKNN-LPKNIRLRSTLLINLRPTAGIQ 182 EG+KD G TEKNN LPKNIRLRST+L+NLRP GIQ Sbjct: 302 EGEKDRGKTEKNNNLPKNIRLRSTILMNLRPAVGIQ 337