BLASTX nr result
ID: Catharanthus22_contig00021361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021361 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein A... 56 6e-06 >ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus sinensis] Length = 491 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/83 (33%), Positives = 43/83 (51%) Frame = +1 Query: 4 CSKEPETLLHALRDCT*CSPIWKRLVRRSEWWDFSIARSTQEWIDFNLHNSREASENNLK 183 C ET LH LRDC +W +L+ SEW + + +W+ NL S + EN L+ Sbjct: 320 CGVASETTLHVLRDCFMAKRLWNQLLP-SEWRQVFFSSNLLDWLTLNLR-SNQCMENGLE 377 Query: 184 WSILFKEVVNSVWY*RNKQIHNE 252 WS +F + +W+ RN+ N+ Sbjct: 378 WSCMFGVAIWRLWFWRNQYQFNK 400