BLASTX nr result
ID: Catharanthus22_contig00021181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021181 (492 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386100.1| hypothetical protein POPTR_0003s22100g [Popu... 53 3e-12 ref|XP_004250870.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 50 5e-11 ref|XP_006354271.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 49 6e-11 gb|EOY32552.1| Glycosyltransferase C20, putative [Theobroma cacao] 50 4e-10 ref|XP_006445999.1| hypothetical protein CICLE_v10017937mg [Citr... 48 4e-10 ref|XP_006445993.1| hypothetical protein CICLE_v10015056mg [Citr... 48 4e-10 ref|XP_006445995.1| hypothetical protein CICLE_v10015019mg [Citr... 49 5e-10 ref|XP_002513452.1| UDP-glucosyltransferase, putative [Ricinus c... 49 7e-10 ref|XP_002297794.2| UDP-glucoronosyl/UDP-glucosyl transferase fa... 49 1e-09 ref|XP_002283018.1| PREDICTED: UDP-glycosyltransferase 92A1 [Vit... 49 2e-09 ref|XP_006493672.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 47 2e-09 ref|XP_006446003.1| hypothetical protein CICLE_v10018270mg [Citr... 47 2e-09 ref|XP_006445997.1| hypothetical protein CICLE_v10017612mg [Citr... 54 3e-09 ref|XP_006445992.1| hypothetical protein CICLE_v10015045mg [Citr... 46 5e-09 ref|XP_006445998.1| hypothetical protein CICLE_v10017546mg [Citr... 44 9e-09 ref|XP_006348417.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 43 4e-08 gb|AFO63526.1| UDP-glucosyltransferase [Panax notoginseng] 45 2e-07 ref|XP_006493647.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 45 2e-07 ref|XP_006445994.1| hypothetical protein CICLE_v10015021mg [Citr... 45 2e-07 ref|XP_002283024.1| PREDICTED: UDP-glycosyltransferase 92A1-like... 47 3e-07 >ref|XP_006386100.1| hypothetical protein POPTR_0003s22100g [Populus trichocarpa] gi|550343758|gb|ERP63897.1| hypothetical protein POPTR_0003s22100g [Populus trichocarpa] Length = 490 Score = 52.8 bits (125), Expect(2) = 3e-12 Identities = 22/50 (44%), Positives = 32/50 (64%) Frame = +1 Query: 271 SLLVLNFFSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 SL + F +I++D V++ +G P C+I D FFGW A++AHEF F F Sbjct: 95 SLSLKPAFRKIISDHVKEQKGHPPFCIITDMFFGWCAEIAHEFGAFHAIF 144 Score = 44.3 bits (103), Expect(2) = 3e-12 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I SG G FGF+ +YS+WLNLPH+N+ Sbjct: 141 HAIFSGCGGFGFACYYSLWLNLPHQNN 167 >ref|XP_004250870.1| PREDICTED: UDP-glycosyltransferase 92A1-like [Solanum lycopersicum] Length = 494 Score = 49.7 bits (117), Expect(2) = 5e-11 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +1 Query: 334 EKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 EKPLCVI D FFGWSA+VAHEF +F F Sbjct: 110 EKPLCVISDMFFGWSANVAHEFGIFHVIF 138 Score = 43.1 bits (100), Expect(2) = 5e-11 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 HVI SG G FG + +YSMWLNLPH+ + Sbjct: 135 HVIFSGAGGFGLACYYSMWLNLPHKET 161 >ref|XP_006354271.1| PREDICTED: UDP-glycosyltransferase 92A1-like [Solanum tuberosum] Length = 494 Score = 49.3 bits (116), Expect(2) = 6e-11 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +1 Query: 334 EKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 EKPLCVI D FFGWSA++AHEF +F F Sbjct: 110 EKPLCVISDMFFGWSANIAHEFGIFHVIF 138 Score = 43.1 bits (100), Expect(2) = 6e-11 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 HVI SG G FG + +YSMWLNLPH+ + Sbjct: 135 HVIFSGAGGFGLACYYSMWLNLPHKKT 161 >gb|EOY32552.1| Glycosyltransferase C20, putative [Theobroma cacao] Length = 505 Score = 50.4 bits (119), Expect(2) = 4e-10 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ D +++ G+ PLC+IGD FFGW A +A E VF F Sbjct: 102 FKDLIEDIIQQQDGQLPLCIIGDIFFGWMAGIAQELGVFHAVF 144 Score = 39.3 bits (90), Expect(2) = 4e-10 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHR 484 H + SG G FG + +YS+WLNLPH+ Sbjct: 141 HAVFSGAGGFGLACYYSIWLNLPHK 165 >ref|XP_006445999.1| hypothetical protein CICLE_v10017937mg [Citrus clementina] gi|557548610|gb|ESR59239.1| hypothetical protein CICLE_v10017937mg [Citrus clementina] Length = 494 Score = 48.1 bits (113), Expect(2) = 4e-10 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ D +++ G KPLC+I D FFGW ++A E+ +F F Sbjct: 102 FKKLVNDLIDEQNGYKPLCIITDMFFGWCKEIAQEYGIFHAIF 144 Score = 41.6 bits (96), Expect(2) = 4e-10 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I G G FGF+ +YS+W+NLPHRN+ Sbjct: 141 HAIFIGGGGFGFACYYSLWVNLPHRNT 167 >ref|XP_006445993.1| hypothetical protein CICLE_v10015056mg [Citrus clementina] gi|557548604|gb|ESR59233.1| hypothetical protein CICLE_v10015056mg [Citrus clementina] Length = 487 Score = 48.1 bits (113), Expect(2) = 4e-10 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ D +++ G KPLC+I D FFGW ++A E+ +F F Sbjct: 102 FKKLVNDLIDEQNGYKPLCIITDMFFGWCKEIAQEYGIFHAIF 144 Score = 41.6 bits (96), Expect(2) = 4e-10 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I G G FGF+ +YS+W+NLPHRN+ Sbjct: 141 HAIFIGGGGFGFACYYSLWVNLPHRNT 167 >ref|XP_006445995.1| hypothetical protein CICLE_v10015019mg [Citrus clementina] gi|557548606|gb|ESR59235.1| hypothetical protein CICLE_v10015019mg [Citrus clementina] Length = 494 Score = 48.9 bits (115), Expect(2) = 5e-10 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++++ V + G+KPLC+I D F GW + AHE+ +F F Sbjct: 102 FKKLISELVNEQNGQKPLCIITDMFLGWCKETAHEYGIFHAIF 144 Score = 40.4 bits (93), Expect(2) = 5e-10 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I G G FGF+ FYS+W+NLPHR + Sbjct: 141 HAIFIGGGGFGFACFYSLWVNLPHRKT 167 >ref|XP_002513452.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223547360|gb|EEF48855.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 492 Score = 48.9 bits (115), Expect(2) = 7e-10 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ D + GE PLC+I D FFGW+A VA E VF F Sbjct: 102 FKKLILDITNEQEGEPPLCIIADIFFGWTATVAKELGVFHAIF 144 Score = 40.0 bits (92), Expect(2) = 7e-10 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I SG G FG +++YS+W +LPHRN+ Sbjct: 141 HAIFSGAGGFGLAVYYSVWSSLPHRNA 167 >ref|XP_002297794.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus trichocarpa] gi|550346569|gb|EEE82599.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus trichocarpa] Length = 490 Score = 49.3 bits (116), Expect(2) = 1e-09 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F ++ D VE+ G+ PLC+I D FFGW+A VA E VF F Sbjct: 102 FKTLIEDIVEEQGGKPPLCIIADIFFGWTATVAKELGVFHAIF 144 Score = 38.9 bits (89), Expect(2) = 1e-09 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHR 484 H I SG G FG + +YS+WL+LPHR Sbjct: 141 HAIFSGAGGFGLACYYSVWLSLPHR 165 >ref|XP_002283018.1| PREDICTED: UDP-glycosyltransferase 92A1 [Vitis vinifera] Length = 494 Score = 48.9 bits (115), Expect(2) = 2e-09 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 271 SLLVLNFFSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 SL + F E++ + + + G PLC+I D FFGW+ADVA E VF F Sbjct: 95 SLSLKPAFRELILNLINEQHGCPPLCIIADIFFGWTADVAKELGVFHAIF 144 Score = 38.5 bits (88), Expect(2) = 2e-09 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I SG G FG + +YS+W +LPHRN+ Sbjct: 141 HAIFSGAGGFGLACYYSIWGSLPHRNA 167 >ref|XP_006493672.1| PREDICTED: UDP-glycosyltransferase 92A1-like [Citrus sinensis] Length = 488 Score = 46.6 bits (109), Expect(2) = 2e-09 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ ++ G KP+C+I D FF WSA++A E+ +F F Sbjct: 102 FRKLINGLFDEQNGHKPVCIIADMFFAWSAEIAQEYGIFNALF 144 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 425 GVGIFGFSLFYSMWLNLPHRNS 490 G G FGF+ FYS+WLNLPHR+S Sbjct: 146 GGGSFGFACFYSLWLNLPHRDS 167 >ref|XP_006446003.1| hypothetical protein CICLE_v10018270mg [Citrus clementina] gi|557548614|gb|ESR59243.1| hypothetical protein CICLE_v10018270mg [Citrus clementina] Length = 230 Score = 46.6 bits (109), Expect(2) = 2e-09 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ ++ G KP+C+I D FF WSA++A E+ +F F Sbjct: 102 FRKLINGLFDEQNGHKPVCIIADMFFAWSAEIAQEYGIFNALF 144 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 425 GVGIFGFSLFYSMWLNLPHRNS 490 G G FGF+ FYS+WLNLPHR+S Sbjct: 146 GGGSFGFACFYSLWLNLPHRDS 167 >ref|XP_006445997.1| hypothetical protein CICLE_v10017612mg [Citrus clementina] gi|557548608|gb|ESR59237.1| hypothetical protein CICLE_v10017612mg [Citrus clementina] Length = 210 Score = 53.5 bits (127), Expect(2) = 3e-09 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F E+++ KN+G+ PLC+I D FFGW+ VA EF +F +F Sbjct: 103 FKEVISSLTRKNQGQPPLCIIADIFFGWTCGVAKEFNLFHAFF 145 Score = 33.1 bits (74), Expect(2) = 3e-09 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHR 484 H SG +G + +YS W NLPH+ Sbjct: 142 HAFFSGASSYGLACYYSFWTNLPHK 166 >ref|XP_006445992.1| hypothetical protein CICLE_v10015045mg [Citrus clementina] gi|557548603|gb|ESR59232.1| hypothetical protein CICLE_v10015045mg [Citrus clementina] Length = 488 Score = 46.2 bits (108), Expect(2) = 5e-09 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ +++ G KP+C+I D FF WSA++A E +F F Sbjct: 102 FRKLINGLIDEQNGHKPVCIIADMFFAWSAEIAQECGIFNALF 144 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 425 GVGIFGFSLFYSMWLNLPHRNS 490 G G FGF+ FYS+W+NLPHR+S Sbjct: 146 GGGSFGFACFYSLWVNLPHRDS 167 >ref|XP_006445998.1| hypothetical protein CICLE_v10017546mg [Citrus clementina] gi|557548609|gb|ESR59238.1| hypothetical protein CICLE_v10017546mg [Citrus clementina] Length = 453 Score = 44.3 bits (103), Expect(2) = 9e-09 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++ ++ G KP+C+I D FF WSA++A E +F F Sbjct: 102 FRKLINGLFDEQNGHKPVCIIADMFFAWSAEIAQECGIFNTLF 144 Score = 40.8 bits (94), Expect(2) = 9e-09 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 425 GVGIFGFSLFYSMWLNLPHRNS 490 G G FGF+ FYS+WLNLPHR+S Sbjct: 146 GGGSFGFACFYSLWLNLPHRDS 167 >ref|XP_006348417.1| PREDICTED: UDP-glycosyltransferase 92A1-like, partial [Solanum tuberosum] Length = 484 Score = 43.1 bits (100), Expect(2) = 4e-08 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +1 Query: 292 FSEILADFVEKNRG---EKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F IL + V G + P+CV+ DFFFGWSA V HEF + F Sbjct: 100 FRFILTNLVNLKIGFFKKPPICVVSDFFFGWSAKVTHEFDILHSIF 145 Score = 39.7 bits (91), Expect(2) = 4e-08 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 Query: 407 LHVISSGVGIFGFSLFYSMWLNLPHRNS 490 LH I G G FG + +YSMW+NLPH+++ Sbjct: 141 LHSIFVGAGGFGLACYYSMWMNLPHKHT 168 >gb|AFO63526.1| UDP-glucosyltransferase [Panax notoginseng] Length = 495 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++D V G PL VI D FFGW+A+VAHEF +F F Sbjct: 102 FRNLISDLVRG--GAPPLAVIADIFFGWTAEVAHEFGIFHTIF 142 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPH 481 H I S G FG + +YS+W+NLPH Sbjct: 139 HTIFSSTGGFGMACYYSVWMNLPH 162 >ref|XP_006493647.1| PREDICTED: UDP-glycosyltransferase 92A1-like [Citrus sinensis] Length = 494 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++++ V + G+KPLC+I D F GW + A E+ +F F Sbjct: 102 FKKLISELVNEQNGQKPLCIITDTFLGWCKETAQEYGIFHAIF 144 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I G G FGF+ YSM LNLPHR++ Sbjct: 141 HAIFIGGGGFGFACLYSMLLNLPHRST 167 >ref|XP_006445994.1| hypothetical protein CICLE_v10015021mg [Citrus clementina] gi|557548605|gb|ESR59234.1| hypothetical protein CICLE_v10015021mg [Citrus clementina] Length = 494 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++++ V + G+KPLC+I D F GW + A E+ +F F Sbjct: 102 FKKLISELVNEQNGQKPLCIITDTFLGWCKETAQEYGIFHAIF 144 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPHRNS 490 H I G G FGF+ YSM LNLPHR++ Sbjct: 141 HAIFIGGGGFGFACLYSMLLNLPHRST 167 >ref|XP_002283024.1| PREDICTED: UDP-glycosyltransferase 92A1-like [Vitis vinifera] Length = 497 Score = 47.0 bits (110), Expect(2) = 3e-07 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 292 FSEILADFVEKNRGEKPLCVIGDFFFGWSADVAHEFVVFTCYF 420 F +++++ + + G PLC++ D FFGWS ++AHEF V F Sbjct: 101 FRKLISELIAEQNGHLPLCLVVDMFFGWSVEIAHEFGVSHAIF 143 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 410 HVISSGVGIFGFSLFYSMWLNLPH 481 H I G G FG + +YS+W N+PH Sbjct: 140 HAIFVGGGGFGMACYYSLWTNMPH 163