BLASTX nr result
ID: Catharanthus22_contig00021121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021121 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65256.1| hypothetical protein L484_025334 [Morus notabilis] 56 6e-06 >gb|EXB65256.1| hypothetical protein L484_025334 [Morus notabilis] Length = 987 Score = 55.8 bits (133), Expect = 6e-06 Identities = 38/98 (38%), Positives = 53/98 (54%), Gaps = 22/98 (22%) Frame = -3 Query: 412 KSQLQPVVALSXXXXXXXXXT----EAIWIQALLSELNLL----------------IRKP 293 KSQLQ VVALS T EAIWIQ LLSEL +L + P Sbjct: 124 KSQLQLVVALSSIEAEYIAGTKGFKEAIWIQGLLSELKILKGNTTIYLDSQSAIHLCKNP 183 Query: 292 LFTNSQSY--VKYHFVREKATNGIIDIMEINTKDHPAD 185 ++ + + V++HF+REK GII + +I+T+D+P+D Sbjct: 184 IYHDKTKHIDVRHHFIREKVEEGIIKLEKIDTEDNPSD 221