BLASTX nr result
ID: Catharanthus22_contig00021043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00021043 (738 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabac... 75 7e-24 gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 67 2e-11 ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507... 60 7e-11 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 59 2e-10 ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 67 6e-09 >ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabacum] gi|56806553|dbj|BAD83454.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 222 Score = 75.1 bits (183), Expect(3) = 7e-24 Identities = 44/88 (50%), Positives = 57/88 (64%), Gaps = 3/88 (3%) Frame = +3 Query: 12 AWFLPLLKRVIIKITVLFVT--LVVSYFAFTWEGTFLAPFL-DFLDGMLSAMEIFPLSVG 182 A F LLKR+ + +TVL +T L+ + F++E F FL DFLD LS M+ PLSVG Sbjct: 17 ALFFSLLKRIFLSLTVLLLTPILLNCNWDFSFEAAFFTSFLSDFLDFWLSLMDRIPLSVG 76 Query: 183 DDRSGASFSKQPSFDLNVPAAEQAVYER 266 D SG S SK+PSFDLN+ AAE+ +R Sbjct: 77 GDGSGPSLSKKPSFDLNISAAEEEPGDR 104 Score = 41.6 bits (96), Expect(3) = 7e-24 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +2 Query: 269 EIKNQKQTLANLLDPFIKKEAEK------YPDIKKLPSPTDVVEQLIRRIGSNKARAEND 430 +IK QK LA + P I+ E + + ++ +LPSP+++VE +I R GS A N Sbjct: 118 KIKEQKDLLAEQISPLIESEKARLVRRKWHRNLDELPSPSEMVEIIIDRFGSKAAYNANK 177 Query: 431 HNAPGISRR 457 N P + R Sbjct: 178 PNVPRANLR 186 Score = 40.8 bits (94), Expect(3) = 7e-24 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = +1 Query: 442 RNLKTWLTRACQNAEDETKGRMSIRSEIRAIIQEY 546 R+L+ WLTRA +AE + KG MSI++ I +II+ Y Sbjct: 186 RHLRAWLTRAQHSAEQDGKGNMSIKNHISSIIEGY 220 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 67.4 bits (163), Expect(2) = 2e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 607 PTPGRVSEPCNRRPFRAVRGALESAAGARQRLDP 708 PTPGRVSEPCNRRPFRAVRGALESAAGAR RL P Sbjct: 124 PTPGRVSEPCNRRPFRAVRGALESAAGARLRLVP 157 Score = 28.1 bits (61), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 582 GPPTNNRYPHP 614 GPPTNNRYP P Sbjct: 116 GPPTNNRYPTP 126 >ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507236 [Cicer arietinum] Length = 614 Score = 59.7 bits (143), Expect(2) = 7e-11 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 605 PPPQAELVSRVIGDHFARFGGHLSQPPAPDSVLTPIQFLGQ 727 P PQAELVSRVIGDHFARFGGHLSQPP +L +F+ Q Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP----ILAESEFVAQ 90 Score = 33.9 bits (76), Expect(2) = 7e-11 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 541 EYSQNDSENSLSFPDRRRIIGTPTP 615 + S +D +S PDRRRIIGTPTP Sbjct: 32 DLSADDDVHSWGAPDRRRIIGTPTP 56 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 58.5 bits (140), Expect(2) = 2e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 605 PPPQAELVSRVIGDHFARFGGHLSQPP 685 P PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP 80 Score = 33.9 bits (76), Expect(2) = 2e-10 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 541 EYSQNDSENSLSFPDRRRIIGTPTP 615 + S +D +S PDRRRIIGTPTP Sbjct: 32 DLSADDDVHSWGAPDRRRIIGTPTP 56 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 67.0 bits (162), Expect = 6e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -3 Query: 736 KRELAQKLDGGQDAVGRRRLTQVPPEPREMVAYYTAH 626 K ELAQK D GQDAVGRRRLTQVP EPREMVAYYTAH Sbjct: 19 KGELAQKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55