BLASTX nr result
ID: Catharanthus22_contig00020982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00020982 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340002.1| PREDICTED: uncharacterized protein LOC102590... 65 9e-09 ref|XP_006340835.1| PREDICTED: uncharacterized protein LOC102593... 64 2e-08 ref|XP_004232563.1| PREDICTED: uncharacterized protein LOC101256... 64 2e-08 ref|XP_004253239.1| PREDICTED: uncharacterized protein LOC101252... 62 6e-08 ref|XP_002280184.1| PREDICTED: uncharacterized protein LOC100252... 60 2e-07 gb|EMJ03834.1| hypothetical protein PRUPE_ppa012068mg [Prunus pe... 58 1e-06 ref|XP_006382996.1| hypothetical protein POPTR_0005s10430g [Popu... 57 3e-06 ref|XP_004287728.1| PREDICTED: uncharacterized protein LOC101299... 57 3e-06 >ref|XP_006340002.1| PREDICTED: uncharacterized protein LOC102590930 [Solanum tuberosum] Length = 174 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKVFK 351 +LSW++G P N+NVMVG+IPWLI+STRVSK++ RK+FK Sbjct: 137 ILSWQSGGPSNENVMVGVIPWLILSTRVSKLICRKIFK 174 >ref|XP_006340835.1| PREDICTED: uncharacterized protein LOC102593949 isoform X1 [Solanum tuberosum] Length = 177 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKVFK 351 +LSWRAG P N+NVMVGIIPWLI+STRV K ++R++FK Sbjct: 140 MLSWRAGGPANENVMVGIIPWLILSTRVGKSISRRIFK 177 >ref|XP_004232563.1| PREDICTED: uncharacterized protein LOC101256829 [Solanum lycopersicum] Length = 177 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKVFK 351 +LSWRAG P N+NVMVGIIPWLI+STRV K ++R++FK Sbjct: 140 MLSWRAGGPANENVMVGIIPWLILSTRVGKSISRRIFK 177 >ref|XP_004253239.1| PREDICTED: uncharacterized protein LOC101252673 [Solanum lycopersicum] Length = 174 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKVFK 351 +LSWR+G N+NVMVG+IPWL++STRVSK++ RK+FK Sbjct: 137 ILSWRSGGSSNENVMVGVIPWLMLSTRVSKLICRKIFK 174 >ref|XP_002280184.1| PREDICTED: uncharacterized protein LOC100252414 [Vitis vinifera] gi|296088655|emb|CBI37646.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKV 357 VLSWR+G NDNVMVGIIPWLI+STRVSK + RKV Sbjct: 139 VLSWRSGVSSNDNVMVGIIPWLILSTRVSKFICRKV 174 >gb|EMJ03834.1| hypothetical protein PRUPE_ppa012068mg [Prunus persica] Length = 184 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVAR 363 VLSWRAG +N+NVMVGIIPWLI+STRVSK V R Sbjct: 143 VLSWRAGGILNENVMVGIIPWLILSTRVSKFVCR 176 >ref|XP_006382996.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] gi|566170573|ref|XP_006382997.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] gi|566170575|ref|XP_002307214.2| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] gi|550338559|gb|ERP60793.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] gi|550338560|gb|ERP60794.1| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] gi|550338561|gb|EEE94210.2| hypothetical protein POPTR_0005s10430g [Populus trichocarpa] Length = 181 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 461 LSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVARKV 357 LSWRAG +N+NVMVGIIPWLI+STRVSK V R + Sbjct: 145 LSWRAGGRLNNNVMVGIIPWLILSTRVSKFVCRLI 179 >ref|XP_004287728.1| PREDICTED: uncharacterized protein LOC101299802 [Fragaria vesca subsp. vesca] Length = 176 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 464 VLSWRAGDPVNDNVMVGIIPWLIVSTRVSKIVAR 363 V+SWRAG +N NVMVGIIPWLI+STRVSK V R Sbjct: 139 VISWRAGGVLNGNVMVGIIPWLILSTRVSKFVCR 172