BLASTX nr result
ID: Catharanthus22_contig00020673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00020673 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524744.1| PREDICTED: endoplasmic reticulum-Golgi inter... 85 9e-15 ref|XP_004504780.1| PREDICTED: endoplasmic reticulum-Golgi inter... 84 3e-14 ref|NP_001242045.1| uncharacterized protein LOC100781612 [Glycin... 84 3e-14 gb|ESW31085.1| hypothetical protein PHAVU_002G207900g [Phaseolus... 82 1e-13 gb|ACJ84247.1| unknown [Medicago truncatula] 81 1e-13 ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate com... 81 2e-13 gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein... 80 4e-13 ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi inter... 79 5e-13 ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi inter... 79 5e-13 ref|XP_006472628.1| PREDICTED: endoplasmic reticulum-Golgi inter... 79 8e-13 ref|XP_006434016.1| hypothetical protein CICLE_v10001505mg [Citr... 79 8e-13 ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi inter... 78 1e-12 ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi inter... 78 1e-12 gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus... 78 1e-12 ref|XP_006305051.1| hypothetical protein CARUB_v10009417mg [Caps... 78 1e-12 ref|NP_001154394.1| Endoplasmic reticulum vesicle transporter pr... 78 1e-12 tpg|DAA37501.1| TPA: DUF1692 domain, endoplasmic reticulum vesci... 78 1e-12 ref|XP_002891208.1| hypothetical protein ARALYDRAFT_891247 [Arab... 78 1e-12 ref|NP_564467.5| Endoplasmic reticulum vesicle transporter prote... 78 1e-12 gb|ACN35132.1| unknown [Zea mays] gi|414586931|tpg|DAA37502.1| T... 78 1e-12 >ref|XP_003524744.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 431 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 152 PEKMDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 P MDK+ NKLRNLDAYPKVNEDFYNRTL+GGV+T+VSA +ML LFFSE Sbjct: 45 PPVMDKVFNKLRNLDAYPKVNEDFYNRTLAGGVVTVVSAAVMLFLFFSE 93 >ref|XP_004504780.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cicer arietinum] Length = 385 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MDK+L+KLRNLDAYPKVNEDFYNRTL+GGV+T+VSA IML LFFSE Sbjct: 1 MDKVLHKLRNLDAYPKVNEDFYNRTLTGGVVTVVSAAIMLFLFFSE 46 >ref|NP_001242045.1| uncharacterized protein LOC100781612 [Glycine max] gi|255644390|gb|ACU22700.1| unknown [Glycine max] Length = 384 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MDK+ NKLRNLDAYPKVNEDFYNRTL+GGV+T+VSA +ML LFFSE Sbjct: 1 MDKVFNKLRNLDAYPKVNEDFYNRTLAGGVVTVVSAAVMLFLFFSE 46 >gb|ESW31085.1| hypothetical protein PHAVU_002G207900g [Phaseolus vulgaris] Length = 384 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MDK+ NKLRNLDAYPKVNEDFY+RTL+GGV+T+VSA +ML LFFSE Sbjct: 1 MDKVFNKLRNLDAYPKVNEDFYSRTLAGGVVTVVSAAVMLFLFFSE 46 >gb|ACJ84247.1| unknown [Medicago truncatula] Length = 384 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MDK+ NKLRNLDAYPKVNEDFYNRTL+GGV+T+VSA +ML LF SE Sbjct: 1 MDKVFNKLRNLDAYPKVNEDFYNRTLAGGVVTVVSAAVMLFLFISE 46 >ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355516359|gb|AES97982.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] Length = 386 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/46 (78%), Positives = 44/46 (95%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD ++NKLRNLDAYPK+NEDFY+RTLSGG+IT+VS+ +MLLLFFSE Sbjct: 1 MDSIMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSE 46 >gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma cacao] Length = 386 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD ++NKLRNLDAYPK+NEDFY+RTLSGGVITLVS+ +M LFFSE Sbjct: 1 MDGIMNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFFLFFSE 46 >ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cicer arietinum] Length = 386 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD +++KLRNLDAYPK+NEDFY+RTLSGGVITL S+ +MLLLFFSE Sbjct: 1 MDSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSE 46 >ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD +++KLRNLDAYPK+NEDFY+RTLSGGVITL S+ +MLLLFFSE Sbjct: 1 MDSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSE 46 >ref|XP_006472628.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Citrus sinensis] Length = 386 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD ++NK+R+LDAYPK+NEDFY+RT SGGVITLVS+ +MLLLFFSE Sbjct: 1 MDAIMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSE 46 >ref|XP_006434016.1| hypothetical protein CICLE_v10001505mg [Citrus clementina] gi|557536138|gb|ESR47256.1| hypothetical protein CICLE_v10001505mg [Citrus clementina] Length = 379 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD ++NK+R+LDAYPK+NEDFY+RT SGGVITLVS+ +MLLLFFSE Sbjct: 1 MDAIMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSE 46 >ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Setaria italica] Length = 386 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD LL+KLRNLDAYPKVNEDFY+RTLSGG+ITL S+ +MLLLF SE Sbjct: 1 MDGLLSKLRNLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSE 46 >ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3 [Vitis vinifera] gi|302141938|emb|CBI19141.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD ++NKLRNLDAYPK+NEDFY+RTLSGGVITL S+ MLLLF SE Sbjct: 1 MDNIINKLRNLDAYPKINEDFYSRTLSGGVITLASSIFMLLLFISE 46 >gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] Length = 386 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 M+ +++KLRNLDAYPK+NEDFY+RTLSGGVITL S+ IMLLLFFSE Sbjct: 1 MEGIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIIMLLLFFSE 46 >ref|XP_006305051.1| hypothetical protein CARUB_v10009417mg [Capsella rubella] gi|482573762|gb|EOA37949.1| hypothetical protein CARUB_v10009417mg [Capsella rubella] Length = 386 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 M +LNKLRNLDAYPK+NEDFY+RTLSGGVITL+S+ +M LLFFSE Sbjct: 1 MAGILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSE 46 >ref|NP_001154394.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|12324714|gb|AAG52317.1|AC021666_6 unknown protein; 24499-21911 [Arabidopsis thaliana] gi|27808598|gb|AAO24579.1| At1g36050 [Arabidopsis thaliana] gi|110736190|dbj|BAF00066.1| hypothetical protein [Arabidopsis thaliana] gi|332193720|gb|AEE31841.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 386 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 M +LNKLRNLDAYPK+NEDFY+RTLSGGVITL+S+ +M LLFFSE Sbjct: 1 MAGILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSE 46 >tpg|DAA37501.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter protein [Zea mays] Length = 268 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD LL+KLR+LDAYPKVNEDFY+RTLSGG+ITLVS+ +MLLLF SE Sbjct: 1 MDGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFVSE 46 >ref|XP_002891208.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. lyrata] gi|297337050|gb|EFH67467.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. lyrata] Length = 386 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 M +LNKLRNLDAYPK+NEDFY+RTLSGGVITL+S+ +M LLFFSE Sbjct: 1 MAGILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSE 46 >ref|NP_564467.5| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|332193719|gb|AEE31840.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 489 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 M +LNKLRNLDAYPK+NEDFY+RTLSGGVITL+S+ +M LLFFSE Sbjct: 1 MAGILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSE 46 >gb|ACN35132.1| unknown [Zea mays] gi|414586931|tpg|DAA37502.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter protein [Zea mays] Length = 391 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 143 MDKLLNKLRNLDAYPKVNEDFYNRTLSGGVITLVSATIMLLLFFSE 6 MD LL+KLR+LDAYPKVNEDFY+RTLSGG+ITLVS+ +MLLLF SE Sbjct: 1 MDGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFVSE 46