BLASTX nr result
ID: Catharanthus22_contig00020625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00020625 (768 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284890.1| PREDICTED: uncharacterized protein LOC100251... 60 1e-06 gb|EOY21881.1| Disulfide bond formation protein B 2, putative [T... 57 9e-06 ref|XP_002514747.1| conserved hypothetical protein [Ricinus comm... 57 9e-06 >ref|XP_002284890.1| PREDICTED: uncharacterized protein LOC100251924 [Vitis vinifera] gi|297733968|emb|CBI15215.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 59.7 bits (143), Expect = 1e-06 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 2/70 (2%) Frame = -3 Query: 547 FIIFLNAIPISRTTNLE--HKSPQVSASSSTNHNMQENGDESRSWINRRIIMEVEVNDYP 374 ++I +NA+P++RT + H+ QVS S N NM++ +E N R M+ E+NDYP Sbjct: 16 YLICVNAVPVARTRRMHGYHQGHQVSEVSFLN-NMEKIWEEQ----NIRARMDAELNDYP 70 Query: 373 GSGANNRHTP 344 GSGANNRHTP Sbjct: 71 GSGANNRHTP 80 >gb|EOY21881.1| Disulfide bond formation protein B 2, putative [Theobroma cacao] Length = 130 Score = 56.6 bits (135), Expect = 9e-06 Identities = 31/68 (45%), Positives = 41/68 (60%) Frame = -3 Query: 544 IIFLNAIPISRTTNLEHKSPQVSASSSTNHNMQENGDESRSWINRRIIMEVEVNDYPGSG 365 I+ LNA+PI+R +L H + +T+ E E++ R M VE+NDYPGSG Sbjct: 61 IVCLNAVPITRIGSLTHGAQVHQVPENTHLVAAEKSSEAQIIKGR---MVVELNDYPGSG 117 Query: 364 ANNRHTPR 341 ANNRHTPR Sbjct: 118 ANNRHTPR 125 >ref|XP_002514747.1| conserved hypothetical protein [Ricinus communis] gi|223546351|gb|EEF47853.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 56.6 bits (135), Expect = 9e-06 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = -3 Query: 544 IIFLNAIPISRTTNLEHKSPQVSASSSTNHNMQENGD-ESRSWINRRIIMEVEVNDYPGS 368 +I LNAIPI+R L H PQV S T H + ++ + E + RI E+NDYPGS Sbjct: 18 LICLNAIPITRIGRLTH-GPQVLTVSETTHMVAKDKNLEEHENLEERIA--AELNDYPGS 74 Query: 367 GANNRHTPRGP 335 GAN+RHTP P Sbjct: 75 GANHRHTPWPP 85