BLASTX nr result
ID: Catharanthus22_contig00020572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00020572 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849758.1| hypothetical protein AMTR_s00024p00251060 [A... 59 7e-07 ref|XP_004304149.1| PREDICTED: uncharacterized protein LOC101295... 59 7e-07 ref|XP_006593393.1| PREDICTED: uncharacterized protein LOC100527... 58 1e-06 ref|XP_006593391.1| PREDICTED: uncharacterized protein LOC100527... 58 1e-06 ref|XP_006373469.1| hypothetical protein POPTR_0017s14060g [Popu... 58 1e-06 ref|XP_004514436.1| PREDICTED: uncharacterized protein LOC101500... 58 1e-06 gb|EMJ18348.1| hypothetical protein PRUPE_ppa003054mg [Prunus pe... 58 1e-06 ref|XP_003637357.1| Zinc finger CCHC domain-containing protein [... 58 1e-06 ref|XP_002887111.1| proline-rich spliceosome-associated family p... 58 1e-06 ref|XP_002525972.1| nucleic acid binding protein, putative [Rici... 58 1e-06 ref|XP_002329267.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_002279557.2| PREDICTED: uncharacterized protein LOC100247... 58 2e-06 emb|CBI16864.3| unnamed protein product [Vitis vinifera] 58 2e-06 gb|EPS69305.1| hypothetical protein M569_05460, partial [Genlise... 57 2e-06 ref|XP_006482308.1| PREDICTED: uncharacterized protein LOC102626... 57 3e-06 ref|XP_006430828.1| hypothetical protein CICLE_v10013582mg, part... 57 3e-06 ref|XP_006405745.1| hypothetical protein EUTSA_v10027714mg [Eutr... 57 3e-06 ref|XP_006391495.1| hypothetical protein EUTSA_v10018682mg [Eutr... 57 3e-06 ref|XP_006405746.1| hypothetical protein EUTSA_v10027714mg [Eutr... 57 4e-06 ref|XP_006283506.1| hypothetical protein CARUB_v10004559mg [Caps... 57 4e-06 >ref|XP_006849758.1| hypothetical protein AMTR_s00024p00251060 [Amborella trichopoda] gi|548853333|gb|ERN11339.1| hypothetical protein AMTR_s00024p00251060 [Amborella trichopoda] Length = 578 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYLGNQ 461 G+GELDPPPWLNRMREIGYPPGYL ++ Sbjct: 316 GIGELDPPPWLNRMREIGYPPGYLDSE 342 >ref|XP_004304149.1| PREDICTED: uncharacterized protein LOC101295545 [Fragaria vesca subsp. vesca] Length = 553 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMREIGYPPGYL Sbjct: 326 GLGELDPPPWLNRMREIGYPPGYL 349 >ref|XP_006593393.1| PREDICTED: uncharacterized protein LOC100527170 isoform X3 [Glycine max] Length = 446 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 210 GLGELDPPPWLNRMRELGYPPGYL 233 >ref|XP_006593391.1| PREDICTED: uncharacterized protein LOC100527170 isoform X1 [Glycine max] gi|571495821|ref|XP_006593392.1| PREDICTED: uncharacterized protein LOC100527170 isoform X2 [Glycine max] Length = 517 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 281 GLGELDPPPWLNRMRELGYPPGYL 304 >ref|XP_006373469.1| hypothetical protein POPTR_0017s14060g [Populus trichocarpa] gi|550320291|gb|ERP51266.1| hypothetical protein POPTR_0017s14060g [Populus trichocarpa] Length = 615 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 374 GLGELDPPPWLNRMRELGYPPGYL 397 >ref|XP_004514436.1| PREDICTED: uncharacterized protein LOC101500938 isoform X1 [Cicer arietinum] gi|502168650|ref|XP_004514437.1| PREDICTED: uncharacterized protein LOC101500938 isoform X2 [Cicer arietinum] Length = 532 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 299 GLGELDPPPWLNRMRELGYPPGYL 322 >gb|EMJ18348.1| hypothetical protein PRUPE_ppa003054mg [Prunus persica] Length = 608 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 G+GELDPPPWLNRMREIGYPPGYL Sbjct: 384 GIGELDPPPWLNRMREIGYPPGYL 407 >ref|XP_003637357.1| Zinc finger CCHC domain-containing protein [Medicago truncatula] gi|355503292|gb|AES84495.1| Zinc finger CCHC domain-containing protein [Medicago truncatula] Length = 543 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 305 GLGELDPPPWLNRMRELGYPPGYL 328 >ref|XP_002887111.1| proline-rich spliceosome-associated family protein [Arabidopsis lyrata subsp. lyrata] gi|297332952|gb|EFH63370.1| proline-rich spliceosome-associated family protein [Arabidopsis lyrata subsp. lyrata] Length = 409 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYLG 467 GL ELDPPPWLNRMREIGYPPGYLG Sbjct: 271 GLKELDPPPWLNRMREIGYPPGYLG 295 >ref|XP_002525972.1| nucleic acid binding protein, putative [Ricinus communis] gi|223534704|gb|EEF36396.1| nucleic acid binding protein, putative [Ricinus communis] Length = 693 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 451 GLGELDPPPWLNRMRELGYPPGYL 474 >ref|XP_002329267.1| predicted protein [Populus trichocarpa] Length = 289 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 205 GLGELDPPPWLNRMRELGYPPGYL 228 >ref|XP_002279557.2| PREDICTED: uncharacterized protein LOC100247996 [Vitis vinifera] Length = 575 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 337 GLGELDPPPWLNRMREMGYPPGYL 360 >emb|CBI16864.3| unnamed protein product [Vitis vinifera] Length = 1165 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWLNRMRE+GYPPGYL Sbjct: 927 GLGELDPPPWLNRMREMGYPPGYL 950 >gb|EPS69305.1| hypothetical protein M569_05460, partial [Genlisea aurea] Length = 298 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGE DPPPWLNRMREIGYPPGYL Sbjct: 206 GLGEFDPPPWLNRMREIGYPPGYL 229 >ref|XP_006482308.1| PREDICTED: uncharacterized protein LOC102626617 [Citrus sinensis] Length = 553 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYLGNQ 461 GLGELDPPPWL+RMRE+GYPPGYL ++ Sbjct: 335 GLGELDPPPWLHRMRELGYPPGYLDSE 361 >ref|XP_006430828.1| hypothetical protein CICLE_v10013582mg, partial [Citrus clementina] gi|557532885|gb|ESR44068.1| hypothetical protein CICLE_v10013582mg, partial [Citrus clementina] Length = 1076 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYLGNQ 461 GLGELDPPPWL+RMRE+GYPPGYL ++ Sbjct: 858 GLGELDPPPWLHRMRELGYPPGYLDSE 884 >ref|XP_006405745.1| hypothetical protein EUTSA_v10027714mg [Eutrema salsugineum] gi|557106883|gb|ESQ47198.1| hypothetical protein EUTSA_v10027714mg [Eutrema salsugineum] Length = 537 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 28/36 (77%), Gaps = 6/36 (16%) Frame = -3 Query: 538 LGELDPPPWLNRMREIGYPPGYL------GNQLFGQ 449 LGELDPPPWLNRMREIGYPPGYL G +FG+ Sbjct: 305 LGELDPPPWLNRMREIGYPPGYLEDDHLSGITIFGE 340 >ref|XP_006391495.1| hypothetical protein EUTSA_v10018682mg [Eutrema salsugineum] gi|567125605|ref|XP_006391496.1| hypothetical protein EUTSA_v10018682mg [Eutrema salsugineum] gi|557087929|gb|ESQ28781.1| hypothetical protein EUTSA_v10018682mg [Eutrema salsugineum] gi|557087930|gb|ESQ28782.1| hypothetical protein EUTSA_v10018682mg [Eutrema salsugineum] Length = 392 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 541 GLGELDPPPWLNRMREIGYPPGYL 470 GLGELDPPPWL+RMREIGYPPGYL Sbjct: 184 GLGELDPPPWLHRMREIGYPPGYL 207 >ref|XP_006405746.1| hypothetical protein EUTSA_v10027714mg [Eutrema salsugineum] gi|557106884|gb|ESQ47199.1| hypothetical protein EUTSA_v10027714mg [Eutrema salsugineum] Length = 539 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 538 LGELDPPPWLNRMREIGYPPGYL 470 LGELDPPPWLNRMREIGYPPGYL Sbjct: 305 LGELDPPPWLNRMREIGYPPGYL 327 >ref|XP_006283506.1| hypothetical protein CARUB_v10004559mg [Capsella rubella] gi|482552211|gb|EOA16404.1| hypothetical protein CARUB_v10004559mg [Capsella rubella] Length = 534 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 538 LGELDPPPWLNRMREIGYPPGYL 470 LGELDPPPWLNRMREIGYPPGYL Sbjct: 320 LGELDPPPWLNRMREIGYPPGYL 342