BLASTX nr result
ID: Catharanthus22_contig00020405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00020405 (2208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484927.1| PREDICTED: uncharacterized protein LOC102626... 50 5e-07 >ref|XP_006484927.1| PREDICTED: uncharacterized protein LOC102626623 [Citrus sinensis] Length = 417 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 24/72 (33%), Positives = 36/72 (50%) Frame = -2 Query: 1442 VGQFFQIRALLRSKKPTPHCIIVEIPGTSRVRASIQYERLPTLCFFCGRIGHIFPQCDVP 1263 +G F ++R + KP +I++ G + I+Y+RLP CF CG IGH F +C Sbjct: 166 IGPFARVRISVDITKPLKRILILKQEGEEDIVMLIKYDRLPDFCFCCGLIGHQFRECIQY 225 Query: 1262 KNSPSRSRLSQG 1227 K P + G Sbjct: 226 KGQPKEKLIYGG 237 Score = 32.7 bits (73), Expect(2) = 5e-07 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = -1 Query: 1764 AMSRSWKCESPPFKMHVLEDNVLHLIFHTSNTRDYVLNEGPGNFSNQLHIIHQ---WNPI 1594 AM +WK + K+ L DN+ F T + VL EGP +F L ++ + I Sbjct: 59 AMQLAWKT-TKEIKVESLGDNIFVFKFATEQDKKRVLTEGPWHFDKALIVLVEPVGMGSI 117 Query: 1593 TKSPPLVFYYAHFNYCITGLPSWC 1522 + P F + F I G+P C Sbjct: 118 KRQP---FTHTSFWVQIHGMPIKC 138