BLASTX nr result
ID: Catharanthus22_contig00019797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019797 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW26502.1| hypothetical protein PHAVU_003G124500g [Phaseolus... 62 1e-07 ref|NP_001241294.1| chromatin structure-remodeling complex prote... 62 1e-07 ref|XP_004147636.1| PREDICTED: chromatin structure-remodeling co... 60 2e-07 gb|AFK36059.1| unknown [Lotus japonicus] 60 2e-07 ref|XP_004297005.1| PREDICTED: chromatin structure-remodeling co... 60 3e-07 gb|ABF85669.1| SNF5 [Pisum sativum] 60 3e-07 ref|XP_003609906.1| Chromatin structure-remodeling complex prote... 60 4e-07 ref|XP_002519347.1| snf5, putative [Ricinus communis] gi|2235416... 60 4e-07 gb|EXB80272.1| Chromatin structure-remodeling complex protein BS... 59 5e-07 gb|ADN34046.1| SNF5-like protein BSH [Cucumis melo subsp. melo] 59 5e-07 ref|XP_004508071.1| PREDICTED: chromatin structure-remodeling co... 59 7e-07 ref|XP_004508070.1| PREDICTED: chromatin structure-remodeling co... 59 7e-07 ref|XP_002270283.1| PREDICTED: chromatin structure-remodeling co... 59 9e-07 emb|CAN81307.1| hypothetical protein VITISV_026538 [Vitis vinifera] 59 9e-07 gb|EMJ27270.1| hypothetical protein PRUPE_ppa010726mg [Prunus pe... 58 1e-06 ref|XP_006378037.1| hypothetical protein POPTR_0010s00670g [Popu... 57 2e-06 ref|XP_002315477.2| transcription regulatory protein SNF5 [Popul... 57 2e-06 ref|XP_006488701.1| PREDICTED: chromatin structure-remodeling co... 55 7e-06 ref|XP_006419193.1| hypothetical protein CICLE_v10005749mg [Citr... 55 7e-06 ref|XP_006419192.1| hypothetical protein CICLE_v10005749mg [Citr... 55 7e-06 >gb|ESW26502.1| hypothetical protein PHAVU_003G124500g [Phaseolus vulgaris] Length = 240 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVDALEAKEER+ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDALEAKEERNFR 240 >ref|NP_001241294.1| chromatin structure-remodeling complex protein BSH-like [Glycine max] gi|296932945|gb|ADH93593.1| SNF5-type chromatin-remodeling complex protein [Glycine max] gi|297179845|gb|ADI23919.1| SNF5 [Glycine max] Length = 240 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVDALEAKEER+ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDALEAKEERNFR 240 >ref|XP_004147636.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like [Cucumis sativus] gi|449498785|ref|XP_004160633.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like [Cucumis sativus] Length = 240 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR++WD+Y+PIVDLLSNEEVDALEAKEER+ R Sbjct: 209 KRKDWDIYEPIVDLLSNEEVDALEAKEERTAR 240 >gb|AFK36059.1| unknown [Lotus japonicus] Length = 240 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVDALEAKEER R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDALEAKEERIFR 240 >ref|XP_004297005.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like [Fragaria vesca subsp. vesca] Length = 238 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLS+EEVDALEAKEER+ R Sbjct: 207 KRKEWDVYEPIVDLLSSEEVDALEAKEERNAR 238 >gb|ABF85669.1| SNF5 [Pisum sativum] Length = 240 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVD LEAKEER+ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDVLEAKEERNFR 240 >ref|XP_003609906.1| Chromatin structure-remodeling complex protein BSH [Medicago truncatula] gi|355510961|gb|AES92103.1| Chromatin structure-remodeling complex protein BSH [Medicago truncatula] Length = 240 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVD LEAKEER+ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDILEAKEERNFR 240 >ref|XP_002519347.1| snf5, putative [Ricinus communis] gi|223541662|gb|EEF43211.1| snf5, putative [Ricinus communis] Length = 241 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEV+ALEA+E+R+VR Sbjct: 210 KRKEWDVYEPIVDLLSNEEVEALEAREDRNVR 241 >gb|EXB80272.1| Chromatin structure-remodeling complex protein BSH [Morus notabilis] Length = 214 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWD+Y+PIVD+LSNEEVDALEA+EER+ R Sbjct: 183 KRKEWDIYEPIVDVLSNEEVDALEAREERNAR 214 >gb|ADN34046.1| SNF5-like protein BSH [Cucumis melo subsp. melo] Length = 149 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR++WD+Y+PIVDLLSNEEVDALEAKEER R Sbjct: 118 KRKDWDIYEPIVDLLSNEEVDALEAKEERIAR 149 >ref|XP_004508071.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like isoform X2 [Cicer arietinum] Length = 240 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVD LEAKEE++ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDVLEAKEEKNFR 240 >ref|XP_004508070.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like isoform X1 [Cicer arietinum] Length = 247 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLSNEEVD LEAKEE++ R Sbjct: 209 KRKEWDVYEPIVDLLSNEEVDVLEAKEEKNFR 240 >ref|XP_002270283.1| PREDICTED: chromatin structure-remodeling complex protein BSH [Vitis vinifera] gi|297736833|emb|CBI26034.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KRREWDVY+PIVD+LSNEEVD LEA+E+R+ R Sbjct: 209 KRREWDVYEPIVDILSNEEVDVLEAREDRNAR 240 >emb|CAN81307.1| hypothetical protein VITISV_026538 [Vitis vinifera] Length = 1328 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KRREWDVY+PIVD+LSNEEVD LEA+E+R+ R Sbjct: 1294 KRREWDVYEPIVDILSNEEVDVLEAREDRNAR 1325 >gb|EMJ27270.1| hypothetical protein PRUPE_ppa010726mg [Prunus persica] Length = 238 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EWDVY+PIVDLLS+EEVDAL+AKEER R Sbjct: 207 KRKEWDVYEPIVDLLSSEEVDALQAKEERLTR 238 >ref|XP_006378037.1| hypothetical protein POPTR_0010s00670g [Populus trichocarpa] gi|550328816|gb|ERP55834.1| hypothetical protein POPTR_0010s00670g [Populus trichocarpa] Length = 276 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR++WDVY P+VDLLSNEEVDALEA+EER+ R Sbjct: 242 KRKDWDVYGPMVDLLSNEEVDALEAREERNAR 273 >ref|XP_002315477.2| transcription regulatory protein SNF5 [Populus trichocarpa] gi|550328815|gb|EEF01648.2| transcription regulatory protein SNF5 [Populus trichocarpa] Length = 244 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR++WDVY P+VDLLSNEEVDALEA+EER+ R Sbjct: 210 KRKDWDVYGPMVDLLSNEEVDALEAREERNAR 241 >ref|XP_006488701.1| PREDICTED: chromatin structure-remodeling complex protein BSH-like [Citrus sinensis] Length = 240 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EW VY+PIVD+LSNEEVDALEA+E+R+ R Sbjct: 209 KRKEWYVYEPIVDILSNEEVDALEAREDRNTR 240 >ref|XP_006419193.1| hypothetical protein CICLE_v10005749mg [Citrus clementina] gi|557521066|gb|ESR32433.1| hypothetical protein CICLE_v10005749mg [Citrus clementina] Length = 240 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EW VY+PIVD+LSNEEVDALEA+E+R+ R Sbjct: 209 KRKEWYVYEPIVDILSNEEVDALEAREDRNTR 240 >ref|XP_006419192.1| hypothetical protein CICLE_v10005749mg [Citrus clementina] gi|557521065|gb|ESR32432.1| hypothetical protein CICLE_v10005749mg [Citrus clementina] Length = 236 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 400 KRREWDVYDPIVDLLSNEEVDALEAKEERSVR 305 KR+EW VY+PIVD+LSNEEVDALEA+E+R+ R Sbjct: 205 KRKEWYVYEPIVDILSNEEVDALEAREDRNTR 236