BLASTX nr result
ID: Catharanthus22_contig00019642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019642 (784 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67235.1| Protein TOPLESS [Morus notabilis] 62 3e-07 ref|XP_006595172.1| PREDICTED: protein TOPLESS-like isoform X3 [... 62 3e-07 ref|XP_006584165.1| PREDICTED: protein TOPLESS-like [Glycine max] 62 3e-07 gb|ESW22775.1| hypothetical protein PHAVU_005G180100g [Phaseolus... 62 3e-07 gb|ESW07769.1| hypothetical protein PHAVU_010G157700g [Phaseolus... 62 3e-07 ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [A... 62 3e-07 gb|EOY25945.1| Transducin family protein / WD-40 repeat family p... 62 3e-07 gb|EOY25941.1| TOPLESS-related 1 isoform 1 [Theobroma cacao] gi|... 62 3e-07 ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [... 62 3e-07 ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [... 62 3e-07 ref|XP_004303268.1| PREDICTED: protein TOPLESS-like [Fragaria ve... 62 3e-07 gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus pe... 62 3e-07 ref|XP_003543688.1| PREDICTED: protein TOPLESS-like isoform X1 [... 62 3e-07 ref|XP_006585625.1| PREDICTED: protein TOPLESS-like isoform X1 [... 62 3e-07 ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communi... 62 3e-07 ref|XP_003599718.1| WD repeat-containing protein, putative [Medi... 62 3e-07 ref|XP_004508472.1| PREDICTED: topless-related protein 4-like is... 60 7e-07 ref|XP_004508471.1| PREDICTED: topless-related protein 4-like is... 60 7e-07 ref|XP_002268265.1| PREDICTED: protein TOPLESS [Vitis vinifera] ... 60 7e-07 ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communi... 60 7e-07 >gb|EXB67235.1| Protein TOPLESS [Morus notabilis] Length = 1138 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAH 236 >ref|XP_006595172.1| PREDICTED: protein TOPLESS-like isoform X3 [Glycine max] Length = 1110 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >ref|XP_006584165.1| PREDICTED: protein TOPLESS-like [Glycine max] Length = 1074 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAH 236 >gb|ESW22775.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris] gi|561024046|gb|ESW22776.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris] Length = 1132 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPASNPLLGSLPKAGGFPPLGAH 236 >gb|ESW07769.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] gi|561008821|gb|ESW07770.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris] Length = 1137 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAH 236 >ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda] gi|548858916|gb|ERN16630.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda] Length = 1138 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/51 (56%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDH+CGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHTCGQPNGARAPSPAGNTLMGAIPKAAGFPPLGAH 236 >gb|EOY25945.1| Transducin family protein / WD-40 repeat family protein isoform 5 [Theobroma cacao] gi|508778690|gb|EOY25946.1| Transducin family protein / WD-40 repeat family protein isoform 5 [Theobroma cacao] Length = 823 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >gb|EOY25941.1| TOPLESS-related 1 isoform 1 [Theobroma cacao] gi|508778686|gb|EOY25942.1| TOPLESS-related 1 isoform 1 [Theobroma cacao] gi|508778687|gb|EOY25943.1| TOPLESS-related 1 isoform 1 [Theobroma cacao] gi|508778688|gb|EOY25944.1| TOPLESS-related 1 isoform 1 [Theobroma cacao] Length = 1142 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [Cicer arietinum] Length = 1149 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANIPLLGSLPKAGGFPPLGAH 236 >ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [Cicer arietinum] Length = 1150 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANIPLLGSLPKAGGFPPLGAH 236 >ref|XP_004303268.1| PREDICTED: protein TOPLESS-like [Fragaria vesca subsp. vesca] Length = 1138 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica] Length = 1139 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >ref|XP_003543688.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max] gi|571503861|ref|XP_006595171.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max] Length = 1132 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >ref|XP_006585625.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max] gi|571472488|ref|XP_006585626.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max] gi|571472490|ref|XP_006585627.1| PREDICTED: protein TOPLESS-like isoform X3 [Glycine max] Length = 1133 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAH 236 >ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis] gi|223543333|gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis] Length = 1115 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 168 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 218 >ref|XP_003599718.1| WD repeat-containing protein, putative [Medicago truncatula] gi|357468121|ref|XP_003604345.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355488766|gb|AES69969.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355505400|gb|AES86542.1| WD repeat-containing protein, putative [Medicago truncatula] gi|484848411|gb|AGK62668.1| topless [Medicago truncatula] Length = 1138 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSLPKAGGFPPLGAH 236 >ref|XP_004508472.1| PREDICTED: topless-related protein 4-like isoform X2 [Cicer arietinum] Length = 1137 Score = 60.5 bits (145), Expect = 7e-07 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPS---------TAKAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAGGFPPLSAH 236 >ref|XP_004508471.1| PREDICTED: topless-related protein 4-like isoform X1 [Cicer arietinum] Length = 1138 Score = 60.5 bits (145), Expect = 7e-07 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPS---------TAKAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAGGFPPLSAH 236 >ref|XP_002268265.1| PREDICTED: protein TOPLESS [Vitis vinifera] gi|297743564|emb|CBI36431.3| unnamed protein product [Vitis vinifera] Length = 1138 Score = 60.5 bits (145), Expect = 7e-07 Identities = 29/51 (56%), Positives = 32/51 (62%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDH+CGQ NGAR+PS A KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAH 236 >ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis] gi|223533443|gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis] Length = 1134 Score = 60.5 bits (145), Expect = 7e-07 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 9/51 (17%) Frame = -2 Query: 129 CMNPGPNPDMKVLFVDHSCGQQNGARSPSTA---------KAVGFSPFDKH 4 C NP PNPD+K LFVDHSCGQ NGAR+PS KA GF P H Sbjct: 186 CKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGALPKAGGFPPLSAH 236